GapMind for Amino acid biosynthesis

 

Alignments for a candidate for ilvC in Acidovorax sp. GW101-3H11

Align acetohydroxyacid isomeroreductase (EC 1.1.1.86) (characterized)
to candidate Ac3H11_527 Ketol-acid reductoisomerase (EC 1.1.1.86)

Query= metacyc::MONOMER-18814
         (338 letters)



>FitnessBrowser__acidovorax_3H11:Ac3H11_527
          Length = 338

 Score =  540 bits (1390), Expect = e-158
 Identities = 263/338 (77%), Positives = 293/338 (86%)

Query: 1   MKVFYDKDADLSLIKGKNVTIIGYGSQGHAHALNLKDSGVNVTVGLRKSGASWNKAANAG 60
           MKVFYDKD DLSLIKGK V IIGYGSQGHAHA NL DSGV V VGLRK GASW+K   AG
Sbjct: 1   MKVFYDKDTDLSLIKGKTVAIIGYGSQGHAHAQNLNDSGVKVVVGLRKGGASWDKVGKAG 60

Query: 61  LQVKEVAEAVKGADVVMILLPDEQIADVYKNEVHDNIKEGAALAFAHGFNVHYGAVIPRA 120
           L V EV +AVK ADVVMILLPDE IA VYKN V  NIK+GA+LAFAHGFNVHY  V+PRA
Sbjct: 61  LNVLEVNDAVKAADVVMILLPDEDIAAVYKNNVEPNIKQGASLAFAHGFNVHYNQVVPRA 120

Query: 121 DLDVIMIAPKAPGHTVRATYTQGGGVPHLIAVHQNKSGAARDIALSYATANGGGRAGIIE 180
           DLDV M+APKAPGHTVR TYTQGGGVPHL+AVHQ+KSG ARD+ALSYA ANGGG+AGIIE
Sbjct: 121 DLDVWMVAPKAPGHTVRNTYTQGGGVPHLVAVHQDKSGKARDLALSYAAANGGGKAGIIE 180

Query: 181 TNFREETETDLFGEQAVLCGGTVELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYE 240
           TNF+EETETDLFGEQAVLCGG VELIK G+ETLVEAGYAPEMAYFECLHELKLIVDLIYE
Sbjct: 181 TNFKEETETDLFGEQAVLCGGAVELIKMGYETLVEAGYAPEMAYFECLHELKLIVDLIYE 240

Query: 241 GGIANMNYSISNNAEYGEYVTGPRVVTEETKKAMKQCLTDIQTGEYAKSFLLENKAGAPT 300
           GGIANMNYSISNNAEYGEYVTGP V+ E+++ AM+  L  IQ G+YAK F+ E +   P+
Sbjct: 241 GGIANMNYSISNNAEYGEYVTGPEVINEQSRAAMRNALKRIQNGDYAKMFIQEGRLNYPS 300

Query: 301 LISRRRLTAEHQIEEVGAKLRAMMPWIAKNKMVDQSKN 338
           + +RRR TA+H IE+VG++LRAMMPWIAKNK+VDQ++N
Sbjct: 301 MTARRRNTADHSIEKVGSQLRAMMPWIAKNKLVDQTRN 338


Lambda     K      H
   0.316    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 484
Number of extensions: 13
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 338
Length of database: 338
Length adjustment: 28
Effective length of query: 310
Effective length of database: 310
Effective search space:    96100
Effective search space used:    96100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)

Align candidate Ac3H11_527 (Ketol-acid reductoisomerase (EC 1.1.1.86))
to HMM TIGR00465 (ilvC: ketol-acid reductoisomerase (EC 1.1.1.86))

Software error:

../bin/blast/fastacmd -i /tmp/list.3912.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.3912.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.