Align succinyldiaminopimelate transaminase (EC 2.6.1.17) (characterized)
to candidate Ac3H11_2404 Aspartate aminotransferase (EC 2.6.1.1)
Query= BRENDA::P9WPZ5 (397 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2404 Length = 388 Score = 280 bits (716), Expect = 5e-80 Identities = 158/388 (40%), Positives = 219/388 (56%), Gaps = 12/388 (3%) Query: 4 SRLRPYATTVFAEMSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYPPGPGS 63 S+L TT+F MSALA AVNLGQGFPD + P+++ A A+ G NQYPP PG Sbjct: 13 SKLPNVGTTIFTVMSALAAEHKAVNLGQGFPDFECAPELVNAVTAAMQAGHNQYPPMPGI 72 Query: 64 APLRRAIAAQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYS 123 LR A+A + G Y+P TE+ +T GAT+AI A+L +V G EV++++P YDSY Sbjct: 73 PALREAVARKIEALHGRAYNPNTEITITAGATQAIITAILAIVHAGDEVIVLDPCYDSYV 132 Query: 124 PVVAMAGAHRVTVPLVPDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAA 183 P + +AG V VPL P F D + A+TPRTRA+++NSPHNP+ + +A E+ Sbjct: 133 PNIELAGGKAVRVPLTPG--TFRPDFAKISAAITPRTRAILVNSPHNPSATIWTAEEMRQ 190 Query: 184 IAEIAVAANLVVITDEVYEHLVFDHARHLPLAGFDGMAERTITISSAAKMFNCTGWKIGW 243 + ++ ++++I+DEVYEH+VFD A H A F G+A R +SS K F+ TGWK+G Sbjct: 191 LEDLLAPTDILLISDEVYEHMVFDGAEHESAARFPGLAARAFIVSSFGKTFHVTGWKVGT 250 Query: 244 ACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAAGLT 303 PA L A R Q+ + P Q +A L + A L +A+RD GL+ Sbjct: 251 VAAPAALTAEFRKVHQFNVFTVNTPVQHGLAAYLQ-DPAPYLQLPAFYQAKRDLFREGLS 309 Query: 304 EIGFAVHDSYGTYFLCADPRPLGYDDSTEFCAALPEKVGVAAIPMSAFCDPAAGQASQQA 363 F + S G+YF C D + + +FC L +VGVAAIP+SAF Q Sbjct: 310 GSRFKLLPSTGSYFQCVDISAISDLNEADFCQWLTREVGVAAIPLSAFYGDGFDQ----- 364 Query: 364 DVWNHLVRFTFCKRDDTLDEAIRRLSVL 391 +VRF F K+D+TL A+ RL L Sbjct: 365 ----RVVRFCFAKKDETLRAALERLRKL 388 Lambda K H 0.321 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 388 Length adjustment: 31 Effective length of query: 366 Effective length of database: 357 Effective search space: 130662 Effective search space used: 130662 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory