Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (characterized)
to candidate Ac3H11_2296 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117)
Query= CharProtDB::CH_024869 (274 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2296 Length = 277 Score = 360 bits (923), Expect = e-104 Identities = 181/274 (66%), Positives = 216/274 (78%), Gaps = 4/274 (1%) Query: 2 QQLQNIIETAFERRAEITPANADTVTREAVNQVIALLDSGALRVAEKID-GQWVTHQWLK 60 QQLQ II+ A++ RA ++PA A ++AV VIA L++G LRVA + GQW HQW+K Sbjct: 3 QQLQTIIDNAWDNRASLSPAAAPKEIQDAVEHVIAELNNGTLRVATREGVGQWTVHQWIK 62 Query: 61 KAVLLSFRINDNQVIEGAESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQGAFIARN 120 KAVLLSFR+ DN+V++ + ++DKV KFA E + G RVVPPA R+G+FIA+ Sbjct: 63 KAVLLSFRLKDNEVVKAGDLGFYDKVQTKFAHLSEEEMKATGVRVVPPAVARRGSFIAKG 122 Query: 121 TVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIED 180 +LMPSYVNIGAYV EGTMVDTWATVGSCAQIG NVHLSGGVGIGGVLEPLQA PTIIED Sbjct: 123 AILMPSYVNIGAYVGEGTMVDTWATVGSCAQIGSNVHLSGGVGIGGVLEPLQAGPTIIED 182 Query: 181 NCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVVSGNLP- 239 NCFIGARSEVVEGV+VEE SV+ MGVY+GQST I++R TGEI YGRVP+GSVVVSGNLP Sbjct: 183 NCFIGARSEVVEGVVVEENSVLGMGVYLGQSTPIFNRATGEISYGRVPSGSVVVSGNLPK 242 Query: 240 --SKDGKYSLYCAVIVKKVDAKTRGKVGINELLR 271 + YS+Y A+IVK+VDA+TR K IN+LLR Sbjct: 243 TAANGAPYSMYAAIIVKQVDAQTRSKTSINDLLR 276 Lambda K H 0.318 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 277 Length adjustment: 25 Effective length of query: 249 Effective length of database: 252 Effective search space: 62748 Effective search space used: 62748 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate Ac3H11_2296 (2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117))
to HMM TIGR00965 (dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00965.hmm # target sequence database: /tmp/gapView.31911.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00965 [M=271] Accession: TIGR00965 Description: dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-134 431.9 0.9 5.8e-134 431.7 0.9 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2296 2,3,4,5-tetrahydropyridine-2,6-d Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2296 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase ( # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 431.7 0.9 5.8e-134 5.8e-134 1 269 [. 4 276 .. 4 277 .] 0.98 Alignments for each domain: == domain 1 score: 431.7 bits; conditional E-value: 5.8e-134 TIGR00965 1 slqkiietaferraeilpasklikvkeavnesiasldsgalrvaekl.dgqwkvnewvkkav 61 +lq ii++a+++ra + pa++ ++++av+++ia+l++g+lrva + +gqw v++w+kkav lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2296 4 QLQTIIDNAWDNRASLSPAAAPKEIQDAVEHVIAELNNGTLRVATREgVGQWTVHQWIKKAV 65 6899******************************************989************* PP TIGR00965 62 llsfritdnqvlndavnkyfdkvatkfadydedefkeaglrkvpgavvrrgafiaknvvlmp 123 llsfr++dn+v++ + ++dkv tkfa +e+e+k +g+r+vp+av+rrg+fiak +lmp lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2296 66 LLSFRLKDNEVVKAGDLGFYDKVQTKFAHLSEEEMKATGVRVVPPAVARRGSFIAKGAILMP 127 ************************************************************** PP TIGR00965 124 syvnigayvdegtmvdtwatvgscaqigknvhlsggvgiggvleplqakpviiedncfigar 185 syvnigayv egtmvdtwatvgscaqig nvhlsggvgiggvleplqa p+iiedncfigar lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2296 128 SYVNIGAYVGEGTMVDTWATVGSCAQIGSNVHLSGGVGIGGVLEPLQAGPTIIEDNCFIGAR 189 ************************************************************** PP TIGR00965 186 seivegviveegsvismgvfigqstkivdretgeiiygrvpagsvvvsgslps..kdgk.ks 244 se+vegv+vee sv+ mgv++gqst i++r tgei ygrvp+gsvvvsg+lp +g +s lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2296 190 SEVVEGVVVEENSVLGMGVYLGQSTPIFNRATGEISYGRVPSGSVVVSGNLPKtaANGApYS 251 ****************************************************855444338* PP TIGR00965 245 lycavivkkvdaktrgkvsinellr 269 +y a+ivk+vda+tr+k+sin+llr lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2296 252 MYAAIIVKQVDAQTRSKTSINDLLR 276 ************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (271 nodes) Target sequences: 1 (277 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.01 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory