GapMind for Amino acid biosynthesis

 

Aligments for a candidate for hcs in Acidovorax sp. GW101-3H11

Align homocitrate synthase (EC 2.3.3.14) (characterized)
to candidate Ac3H11_530 2-isopropylmalate synthase (EC 2.3.3.13)

Query= BRENDA::D0VY45
         (540 letters)



>lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_530 2-isopropylmalate
           synthase (EC 2.3.3.13)
          Length = 512

 Score =  406 bits (1044), Expect = e-118
 Identities = 240/513 (46%), Positives = 325/513 (63%), Gaps = 21/513 (4%)

Query: 27  ILDTTLRDGEQSPGAAMTCVQKLETARQLAKLGVDIIEAGFPCASKQDFMAVKMIAEEVG 86
           I DTTLRDGEQSPGA+MT  +KL  ARQL +L VD+IEAGF  +S  DF AV+ IA  + 
Sbjct: 7   IFDTTLRDGEQSPGASMTKDEKLRIARQLERLKVDVIEAGFAASSNGDFEAVQAIANAIK 66

Query: 87  NCVDGNGYVPVITGVSRCNEKDIATAWEALKHAKRPRLRTFIATSPIHMEYKLRKSKDQV 146
           +          I  +SR N++DI+ A EAL+ A   R+ TFIATS +HME KLR + +QV
Sbjct: 67  DST--------ICSLSRANDRDISRAAEALRGANSARIHTFIATSALHMEKKLRMTPEQV 118

Query: 147 LETARNMVKFARSLGCTDIQFGAEDAARSDKEFLYQIFGEVIKAGATTLTIPDTVGIAMP 206
           LE A+  V+FAR+L   DI+F  ED  RSD +FL ++   VI  GATT+ +PDTVG A+P
Sbjct: 119 LEQAKQSVRFARNL-VADIEFSPEDGYRSDPDFLCRVLEAVITEGATTINVPDTVGYAVP 177

Query: 207 FEYGKLIADIKANTPGIENAIMATHCHNDLGLATANTIEGARY-GARQLEVTINGIGERA 265
             YG  I  ++   P  + AI + HCHNDLG+A AN++ G +  GARQ+E TING+GERA
Sbjct: 178 ELYGNFIKTLRERIPNSDKAIWSVHCHNDLGMAVANSLAGVKIGGARQVECTINGLGERA 237

Query: 266 GNASFEEVVMALTCRGIDILGGLHTGINTRHILKTSKMVEKYSGLHLQPHKALVGANAFL 325
           GN S EE+VMA+  R      GL   I+T+HI+  S+MV + +G  +QP+KA+VGANAF 
Sbjct: 238 GNCSLEEIVMAVKTR--KDYFGLDLAIDTQHIVAASRMVSQTTGFVVQPNKAVVGANAFA 295

Query: 326 HESGIHQDGMLKHRGTYEIISPEDIGLVRSVGDTIVLGKLSGRQALRNRLEELGYKL-KD 384
           H SGIHQDG+LK R TYEI+  ED+G      + IVLGKLSGR A + RL+ELG +L  +
Sbjct: 296 HASGIHQDGVLKARDTYEIMRAEDVGW---SANKIVLGKLSGRNAFKQRLQELGVQLDSE 352

Query: 385 TEVEGVFWQFKAVAEKKKRITDTDLRALVSNEAFN-EQPIWKLGDLQVTCGTVGFSTATV 443
           TE+   F +FK +A++K  I D D+ ALVS+E+   E+  +    L     T     A +
Sbjct: 353 TEINVAFAKFKELADRKSEIFDEDILALVSDESVTAEKEQYGFVSLFQQSETGEQPRARI 412

Query: 444 KLFSIDGSMHVACSIGTGPVDSAYKAINHIVKEPAKLVKYTLGAITEGIDATATTSVEIS 503
            +F++DG      S G GPVD++ KAI   VK  A++V Y++ AI+   ++    +V + 
Sbjct: 413 -VFTVDGQEVRGESDGNGPVDASLKAIESHVKSGAEMVLYSVNAISGSTESQGEVTVRLQ 471

Query: 504 RGDTNHPVFSGTGGGTDVVVSSVDAYLSALNNM 536
                  V +G G   D+VV+S  AYLSALN +
Sbjct: 472 NSGR---VVNGVGADPDIVVASAKAYLSALNKL 501


Lambda     K      H
   0.318    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 600
Number of extensions: 21
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 540
Length of database: 512
Length adjustment: 35
Effective length of query: 505
Effective length of database: 477
Effective search space:   240885
Effective search space used:   240885
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory