Align Aromatic-amino-acid aminotransferase 2; ARAT-II; AROAT; EC 2.6.1.57 (characterized)
to candidate Ac3H11_1602 Aspartate aminotransferase (EC 2.6.1.1)
Query= SwissProt::H3ZPU1 (389 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1602 Length = 408 Score = 242 bits (618), Expect = 1e-68 Identities = 149/395 (37%), Positives = 225/395 (56%), Gaps = 22/395 (5%) Query: 4 SDRLEMVNPSEIRKLFDLAQGI----EGIISLGIGEPDFDTPEHIKEYAKEALDKGLTHY 59 +DRL + SEI +L A + + +I LG+GEPDFDTP HI E A++A+ +G THY Sbjct: 13 ADRLGAIGVSEIVRLTQEANQLKRQGQPVIVLGLGEPDFDTPAHILEAAQQAMARGETHY 72 Query: 60 SPNIGILELREAVAEKFKKHNGIDADPKTQIMITVGTNQQILMGLATFLKDNEEVLIPSP 119 + G EL+ A+ KFK +NG+D +I G Q + L + +EV++P+P Sbjct: 73 TVLDGTAELKAAIQHKFKHYNGLDFQ-LNEITAGAGAKQILYNALMASVNPGDEVILPAP 131 Query: 120 MFVSYAPAVILAGGKPVEVPTYEENEFRLSVDELEKYVTPKTRALIINTPNNPTGAVLTK 179 + SYA V++AGG PV VP E N FR++ ++LE +TP+TR + IN+P+NP+GA + Sbjct: 132 YWTSYADMVLIAGGVPVVVPCTEANGFRITPEQLEAAITPRTRWVFINSPSNPSGAAYSA 191 Query: 180 KDLEEIADFAVEH-DLMILSDEVYEYFVYDGVKNYSIAS-LDGMFERTITMNGFSKTFAM 237 + L + + H + +L+D++YE+ +YDG + A+ L + +RT+T+NG SK +AM Sbjct: 192 EQLRPVLEVVERHPQVWLLADDIYEHILYDGRAFATPAAVLPSLRDRTLTVNGVSKAYAM 251 Query: 238 TGWRLGFLAAPEWVVEKMVRFQMYNATCPVTFIQYAAAKALRDERSWQAVEEMRREYERR 297 TGWRLG+ A P+ ++ M Q +CP + Q AA AL + V E + ++ R Sbjct: 252 TGWRLGYGAGPKALIAAMAVVQSQATSCPSSISQAAAVAALTGPQ--DVVRERCQAFQDR 309 Query: 298 RNLVWKRLN-EMGLPTVKPKGAFYIFP-------RIKDTGL---SSKEFSELMIKEAKVV 346 R+LV LN GL P+GAFY F R GL + +F +++E V Sbjct: 310 RDLVVAALNVSPGLRCRVPEGAFYTFASCEGALGRTTPGGLLLRTDADFCAYLLREHHVA 369 Query: 347 VVPGSAFGQAGEGYVRISYATAYEKLEEAMDRMEK 381 VVPG G A Y RISYA + L+EA R+++ Sbjct: 370 VVPGGVLGLA--PYFRISYAASTADLQEACARIQR 402 Lambda K H 0.318 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 408 Length adjustment: 31 Effective length of query: 358 Effective length of database: 377 Effective search space: 134966 Effective search space used: 134966 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory