GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argB in Acidovorax sp. GW101-3H11

Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate Ac3H11_1907 Acetylglutamate kinase (EC 2.7.2.8)

Query= BRENDA::Q9HTN2
         (301 letters)



>FitnessBrowser__acidovorax_3H11:Ac3H11_1907
          Length = 317

 Score =  325 bits (833), Expect = 8e-94
 Identities = 168/285 (58%), Positives = 212/285 (74%), Gaps = 5/285 (1%)

Query: 12  AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQ 71
           A++L++ALPYIR+F GKT+VIKYGGNAM    L+A FA DVVL+K VG+NPVVVHGGGPQ
Sbjct: 34  AEILAQALPYIRKFHGKTMVIKYGGNAMTDPALQADFAEDVVLLKLVGMNPVVVHGGGPQ 93

Query: 72  IGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDA 131
           I   L RL  +  FI GMRVTDA TM+VVE VL G+V +DIV LIN+ GG A+GLTG+D 
Sbjct: 94  IETALNRLGKKGEFIQGMRVTDAETMEVVEWVLAGEVQQDIVGLINQAGGKAVGLTGRDG 153

Query: 132 ELIRAKKL-TVTRQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSN 190
            +IRA+KL  V  + P +      D+G VG++  ++  ++  L    FIPVI+PIG G N
Sbjct: 154 GMIRAQKLKMVDNKNPAIEH----DVGQVGDIVSIDPSVVKALQDDAFIPVISPIGFGEN 209

Query: 191 GESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYG 250
            ESYNINAD+VA K+AE LKAEKLMLLTN  G++DK G +LT L+  +++EL ADGTI G
Sbjct: 210 NESYNINADVVASKLAEVLKAEKLMLLTNTPGVLDKAGNLLTDLTARRIDELFADGTISG 269

Query: 251 GMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLI 295
           GMLPKI  AL+A + GV + HIIDGRVP+A+LLEI T+   GT+I
Sbjct: 270 GMLPKIAGALDAAKAGVNAVHIIDGRVPHAMLLEILTEQAYGTMI 314


Lambda     K      H
   0.318    0.138    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 310
Number of extensions: 15
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 301
Length of database: 317
Length adjustment: 27
Effective length of query: 274
Effective length of database: 290
Effective search space:    79460
Effective search space used:    79460
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

Align candidate Ac3H11_1907 (Acetylglutamate kinase (EC 2.7.2.8))
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))

Software error:

../bin/blast/fastacmd -i /tmp/list.2844.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.2844.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.