GapMind for Amino acid biosynthesis

 

Aligments for a candidate for argB in Acidovorax sp. GW101-3H11

Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate Ac3H11_1907 Acetylglutamate kinase (EC 2.7.2.8)

Query= BRENDA::Q9HTN2
         (301 letters)



>lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1907 Acetylglutamate
           kinase (EC 2.7.2.8)
          Length = 317

 Score =  325 bits (833), Expect = 8e-94
 Identities = 168/285 (58%), Positives = 212/285 (74%), Gaps = 5/285 (1%)

Query: 12  AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQ 71
           A++L++ALPYIR+F GKT+VIKYGGNAM    L+A FA DVVL+K VG+NPVVVHGGGPQ
Sbjct: 34  AEILAQALPYIRKFHGKTMVIKYGGNAMTDPALQADFAEDVVLLKLVGMNPVVVHGGGPQ 93

Query: 72  IGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDA 131
           I   L RL  +  FI GMRVTDA TM+VVE VL G+V +DIV LIN+ GG A+GLTG+D 
Sbjct: 94  IETALNRLGKKGEFIQGMRVTDAETMEVVEWVLAGEVQQDIVGLINQAGGKAVGLTGRDG 153

Query: 132 ELIRAKKL-TVTRQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSN 190
            +IRA+KL  V  + P +      D+G VG++  ++  ++  L    FIPVI+PIG G N
Sbjct: 154 GMIRAQKLKMVDNKNPAIEH----DVGQVGDIVSIDPSVVKALQDDAFIPVISPIGFGEN 209

Query: 191 GESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYG 250
            ESYNINAD+VA K+AE LKAEKLMLLTN  G++DK G +LT L+  +++EL ADGTI G
Sbjct: 210 NESYNINADVVASKLAEVLKAEKLMLLTNTPGVLDKAGNLLTDLTARRIDELFADGTISG 269

Query: 251 GMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLI 295
           GMLPKI  AL+A + GV + HIIDGRVP+A+LLEI T+   GT+I
Sbjct: 270 GMLPKIAGALDAAKAGVNAVHIIDGRVPHAMLLEILTEQAYGTMI 314


Lambda     K      H
   0.318    0.138    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 310
Number of extensions: 15
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 301
Length of database: 317
Length adjustment: 27
Effective length of query: 274
Effective length of database: 290
Effective search space:    79460
Effective search space used:    79460
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

Align candidate Ac3H11_1907 (Acetylglutamate kinase (EC 2.7.2.8))
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00761.hmm
# target sequence database:        /tmp/gapView.27360.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00761  [M=231]
Accession:   TIGR00761
Description: argB: acetylglutamate kinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                        Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                        -----------
    1.1e-74  236.9   4.8    1.2e-74  236.7   4.8    1.0  1  lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1907  Acetylglutamate kinase (EC 2.7.2


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1907  Acetylglutamate kinase (EC 2.7.2.8)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  236.7   4.8   1.2e-74   1.2e-74       1     231 []      51     291 ..      51     291 .. 0.97

  Alignments for each domain:
  == domain 1  score: 236.7 bits;  conditional E-value: 1.2e-74
                                        TIGR00761   1 tiViKiGGaais..elleelakdiaklrkegiklvivHGGgpeinelleklgievefvnglR 60 
                                                      t+ViK+GG+a++   l+ ++a+d++ l+ +g+++v+vHGGgp+i+++l++lg + ef++g+R
  lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1907  51 TMVIKYGGNAMTdpALQADFAEDVVLLKLVGMNPVVVHGGGPQIETALNRLGKKGEFIQGMR 112
                                                      69**********9889********************************************** PP

                                        TIGR00761  61 vTdketlevvemvligkvnkelvallekhgikavGltgkDgqlltaekldke.........d 113
                                                      vTd+et+evve vl+g+v++ +v l++++g kavGltg Dg ++ a+kl+           d
  lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1907 113 VTDAETMEVVEWVLAGEVQQDIVGLINQAGGKAVGLTGRDGGMIRAQKLKMVdnknpaiehD 174
                                                      ***********************************************55444446999999* PP

                                        TIGR00761 114 lgyvGeikkvnkelleallkagiipviaslaldeegqllNvnaDtaAaelAaaleAekLvlL 175
                                                      +g vG+i ++++++++al +  +ipvi+++++ e+++ +N+naD++A++lA++l+AekL+lL
  lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1907 175 VGQVGDIVSIDPSVVKALQDDAFIPVISPIGFGENNESYNINADVVASKLAEVLKAEKLMLL 236
                                                      ************************************************************** PP

                                        TIGR00761 176 tdvaGilegdkksliseleleeieqlikqavikgGmipKveaalealesgvkkvvi 231
                                                      t+++G+l++ + +l++ l++++i++l   + i gGm pK++ al+a++ gv++v+i
  lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1907 237 TNTPGVLDK-AGNLLTDLTARRIDELFADGTISGGMLPKIAGALDAAKAGVNAVHI 291
                                                      *********.666*****************************************98 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (231 nodes)
Target sequences:                          1  (317 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 7.39
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory