GapMind for Amino acid biosynthesis

 

Aligments for a candidate for argC in Acidovorax sp. GW101-3H11

Align N-acetyl-gamma-glutamyl-phosphate reductase; AGPR; EC 1.2.1.38; N-acetyl-glutamate semialdehyde dehydrogenase; NAGSA dehydrogenase (uncharacterized)
to candidate Ac3H11_2950 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)

Query= curated2:B1K264
         (313 letters)



>lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2950
           N-acetyl-gamma-glutamyl-phosphate reductase (EC
           1.2.1.38)
          Length = 312

 Score =  448 bits (1152), Expect = e-131
 Identities = 227/305 (74%), Positives = 251/305 (82%), Gaps = 1/305 (0%)

Query: 4   PTVFIDGDQGTTGLQIHARLRDRTDVRLLTLPAAERKDAARRADALNACDIAILCLPDAA 63
           P VFIDGDQGTTGLQIH RLR RTD+ LLTLP AERK+AARRA+A+N CDIAILCLPD A
Sbjct: 5   PLVFIDGDQGTTGLQIHERLRGRTDLHLLTLPDAERKNAARRAEAINHCDIAILCLPDGA 64

Query: 64  AREAVGFIRNPAVRVIDASSAHRTQPDWVYGFPEMADGHAHDIAHAKRVTNPGCYPTGAI 123
           AREAV  I NPAV+VIDASSAHRT P WVYGFPE+       IA A+RV+NPGCYPTGA+
Sbjct: 65  AREAVTAITNPAVQVIDASSAHRTDPQWVYGFPELDAAQPARIASAQRVSNPGCYPTGAV 124

Query: 124 GLLRPLLQAGLLPRDYPVSIHAVSGYSGGGRAAVDAFESGDAAARALPLQVYGLALEHKH 183
            LLRPL+QAGLL R++ V++HAVSGYSGGGRA V+  E G   A+A   Q+YGL LEHKH
Sbjct: 125 ALLRPLVQAGLLGREHAVTVHAVSGYSGGGRARVEEHE-GPGGAQAPAFQLYGLKLEHKH 183

Query: 184 VPEIRQHAGLAHRPFFVPAYGAYRQGIVLTIPIELRLLPAGVTGERLHACLAHHYADARH 243
            PEI QHAGLA RP FVPAYGA+RQGIVL+IP+ +  LPAG +GERLHACL  HYA A H
Sbjct: 184 TPEIAQHAGLAQRPIFVPAYGAFRQGIVLSIPLFVHQLPAGASGERLHACLQQHYAGAAH 243

Query: 244 VDVMPLADAAAATHLDPQALNGTNDLRLGVLVNADGGQVLLSAVFDNLGKGASGAAVQNL 303
           V+VMPLA A AA HLDPQALNGTN LRLGV  NA  GQVLL+AVFDNLGKGASGAAVQNL
Sbjct: 244 VEVMPLAQAEAAEHLDPQALNGTNQLRLGVFSNARHGQVLLTAVFDNLGKGASGAAVQNL 303

Query: 304 DLMLG 308
           DLMLG
Sbjct: 304 DLMLG 308


Lambda     K      H
   0.322    0.138    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 389
Number of extensions: 19
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 313
Length of database: 312
Length adjustment: 27
Effective length of query: 286
Effective length of database: 285
Effective search space:    81510
Effective search space used:    81510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

Align candidate Ac3H11_2950 (N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
to HMM TIGR01851 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01851.hmm
# target sequence database:        /tmp/gapView.25983.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01851  [M=310]
Accession:   TIGR01851
Description: argC_other: N-acetyl-gamma-glutamyl-phosphate reductase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                        Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                        -----------
   5.5e-124  399.4   0.0   6.3e-124  399.2   0.0    1.0  1  lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2950  N-acetyl-gamma-glutamyl-phosphat


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2950  N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  399.2   0.0  6.3e-124  6.3e-124       2     309 ..       5     308 ..       4     309 .. 0.98

  Alignments for each domain:
  == domain 1  score: 399.2 bits;  conditional E-value: 6.3e-124
                                        TIGR01851   2 pkvfidGeaGttGlqirerlaerddlellsidedkrkdaderakllnaadvailclpddaar 63 
                                                      p vfidG++GttGlqi+erl +r+dl+ll++ +  rk+a+ ra+ +n  d+ailclpd aar
  lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2950   5 PLVFIDGDQGTTGLQIHERLRGRTDLHLLTLPDAERKNAARRAEAINHCDIAILCLPDGAAR 66 
                                                      679*********************************************************** PP

                                        TIGR01851  64 eavslvdnpntkildastayrtaedwvyGfpelaaeqrekianakrvanPGcyatgaiallr 125
                                                      eav+ ++np+++++das+a+rt ++wvyGfpel+a q+ +ia+a+rv+nPGcy+tga+allr
  lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2950  67 EAVTAITNPAVQVIDASSAHRTDPQWVYGFPELDAAQPARIASAQRVSNPGCYPTGAVALLR 128
                                                      ************************************************************** PP

                                        TIGR01851 126 PlveaGilPadfPvtinavsGysGGGkaliakyeeesaddskkaafiiyglalehkhlpemr 187
                                                      Plv+aG+l  ++ vt++avsGysGGG+a ++++e    + ++  af+ ygl+lehkh pe+ 
  lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2950 129 PLVQAGLLGREHAVTVHAVSGYSGGGRARVEEHEG--PGGAQAPAFQLYGLKLEHKHTPEIA 188
                                                      *********************************93..33344679***************** PP

                                        TIGR01851 188 khsglaskPiftPavGdfaqGllveiplhlaeldskvsaedihkalaeyykGekfvkvaeld 249
                                                      +h+gla++Pif+Pa G f qG+++ ipl +++l + +s+e +h+ l+++y+G ++v+v++l+
  lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2950 189 QHAGLAQRPIFVPAYGAFRQGIVLSIPLFVHQLPAGASGERLHACLQQHYAGAAHVEVMPLA 250
                                                      ************************************************************** PP

                                        TIGR01851 250 daellddtildaqglngtnrlelfvfgsddgerallvarldnlGkGasGaavqnlnialG 309
                                                      +ae+   + ld+q+lngtn+l l vf+++  +++ll+a +dnlGkGasGaavqnl+++lG
  lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2950 251 QAEAA--EHLDPQALNGTNQLRLGVFSNARHGQVLLTAVFDNLGKGASGAAVQNLDLMLG 308
                                                      ***66..99**************************************************9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (310 nodes)
Target sequences:                          1  (312 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.54
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory