Align acetylornithine transaminase (EC 2.6.1.11); 4-aminobutyrate-2-oxoglutarate transaminase (EC 2.6.1.19) (characterized)
to candidate Ac3H11_1332 Acetylornithine aminotransferase (EC 2.6.1.11)
Query= BRENDA::B1XNF8 (418 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1332 Length = 398 Score = 337 bits (863), Expect = 5e-97 Identities = 173/395 (43%), Positives = 248/395 (62%), Gaps = 11/395 (2%) Query: 23 YVMHTYGRFPVAIAKGEGCRLWDTEGKSYLDFVAGIATCTLGHAHPALIQAVSAQIQKLH 82 +VM+TYGR P+A+ +G+GCR+WD GK Y+D + GIA TLGH H L+ A+ QI KL Sbjct: 11 HVMNTYGRVPIALERGQGCRVWDVNGKEYIDGLGGIAVNTLGHNHGKLVPALQDQIAKLI 70 Query: 83 HISNLYYIPEQGALAQWIVEHSCADKVFFCNSGAEANEAAIKLVRKYAHTVSDFLEQPVI 142 H SN Y++P Q LA +VE S VFFCNSG EANEAA+K+ RK+ V + +P I Sbjct: 71 HTSNYYHVPLQEKLATKLVELSGMQNVFFCNSGLEANEAALKIARKFG--VDKGIAKPEI 128 Query: 143 LSAKSSFHGRTLATITATGQPKYQKHFDPLPDGFAYVPYNDIRALEEAITDIDEGNRRVA 202 + + +FHGR++AT++ATG PK F PL +GF VP NDI A+++A EGN V Sbjct: 129 VVYEKAFHGRSIATMSATGNPKIHNGFGPLVEGFVRVPMNDIEAIKQA----TEGNPNVV 184 Query: 203 AIMLEALQGEGGVRPGDVEYFKAVRRICDENGILLVLDEVQVGVGRTGKYWGYENLGIEP 262 A+ E +QGEGG+ +EY + +R++CDE G L+++DEVQ G+GRTGK++ ++ GI P Sbjct: 185 AVFFETIQGEGGINGMRIEYLQQLRKLCDERGWLMMIDEVQCGMGRTGKWFAHQWAGIVP 244 Query: 263 DIFTSAKGLAGGIPIGAMMCKDSCA-VFNPGEHASTFGGNPFSCAAALAVVETLEQENLL 321 D+ AKGL G+PIGA++ A V PG H +TFGGNP + A + + +E++ LL Sbjct: 245 DVMPLAKGLGSGVPIGAVVAGPKAANVLQPGNHGTTFGGNPLAMRAGVETIRIMEEDGLL 304 Query: 322 ENVNARGEQLRAGLKTLAEKYPYFSDVRGWGLINGMEIKADLELTSIEVVKAAMEKGLLL 381 N G+ LRA L+ P ++RG GL+ G+E+ ++ A E GLLL Sbjct: 305 HNAAQVGDHLRAALQRELGSLPGVKEIRGQGLMLGIELNKPCG----ALIGRAAEAGLLL 360 Query: 382 APAGPKVLRFVPPLIVSAAEINEAIALLDQTLAAM 416 + V+R VPPLI++ AE + +A+L + A+ Sbjct: 361 SVTADSVIRLVPPLILTTAEADAIVAILTPLVKAI 395 Lambda K H 0.319 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 398 Length adjustment: 31 Effective length of query: 387 Effective length of database: 367 Effective search space: 142029 Effective search space used: 142029 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory