Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate Ac3H11_4519 Acetylornithine deacetylase (EC 3.5.1.16)
Query= BRENDA::Q92Y75 (374 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4519 Length = 372 Score = 217 bits (552), Expect = 5e-61 Identities = 124/356 (34%), Positives = 192/356 (53%), Gaps = 9/356 (2%) Query: 21 NNDVVSWIRGYLESHGIAVDVLPGPEGDRSNIFATIGPKEARGYIISGHMDVVPAAETGW 80 N +++ +IR +L G+ + + ++N+FAT+G + G I+SGH D VP W Sbjct: 11 NLELIHFIRDHLAKLGVKSRLTFNEDKTKANLFATLGEGKPAGIILSGHTDTVPWDGQDW 70 Query: 81 TSDPFRLRVEADRLYGRGTTDMKGFLAAVLAAVPKLAAMPLRRPLHLALSYDEEAGCRGV 140 T DP V+ LYGRG+ DMK F+ ++ + +HLA SY+EE GC GV Sbjct: 71 TMDPLSALVKDGNLYGRGSADMKAFIGIAVSHAEQFLHSDAPFAIHLAFSYEEEIGCFGV 130 Query: 141 PHMIARLPELCRQPLGAIIGEPTGMRAIRAHKGKAAARLTVRGRSGHSSRPDQGLNAIHG 200 +IA L + +PL I+GEPT M AHKG + VRG+ HSS +NAI Sbjct: 131 KELIADLRDANIKPLACIVGEPTSMVPAIAHKGVYRYKCCVRGKEAHSSLTPHSVNAIEM 190 Query: 201 VAGVL--TQAVAEADRLVGGPFEHVFEPPYSSLQIGTVKGGQAVNIIPDSCEVEFEARAI 258 A V+ + +AE FE F+ P+S+ +G GG A N++P E +E R + Sbjct: 191 AARVVGRVRDMAEGFEKNEPRFEG-FDVPFSTSSVGQFHGGIADNVVPRDAEFRYEFRDL 249 Query: 259 SGVDPAELLAPVRKTAEALTTLGFEV------EWQELSAYPALSLEPDAPLAALLEELTG 312 + A++ A V A++L +V ++ + P+ D P+ L +EL+G Sbjct: 250 PTANAAQMQAEVVAYAKSLEPAMKKVAPAAGFAFETICEIPSFLGSKDDPVTRLAQELSG 309 Query: 313 REALPAVSYGTEAGLFQRAGIDAIICGPGDIGRAHKPDEYILIDELMACRAMVEAL 368 ++ V++GTEAGLF+ AGI ++CGPG I +AH+PDEY+ +++L C A ++ L Sbjct: 310 EKSTTLVAFGTEAGLFKNAGISTVVCGPGSIQQAHQPDEYVSLEQLARCEAFMQGL 365 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 372 Length adjustment: 30 Effective length of query: 344 Effective length of database: 342 Effective search space: 117648 Effective search space used: 117648 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate Ac3H11_4519 (Acetylornithine deacetylase (EC 3.5.1.16))
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.26864.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-107 343.5 0.0 8.5e-107 343.3 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4519 Acetylornithine deacetylase (EC Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4519 Acetylornithine deacetylase (EC 3.5.1.16) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 343.3 0.0 8.5e-107 8.5e-107 7 363 .. 1 364 [. 1 366 [. 0.95 Alignments for each domain: == domain 1 score: 343.3 bits; conditional E-value: 8.5e-107 TIGR01892 7 vafdsvsarsnvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvlsGht 68 v +++vs +sn++li++++d+l++lgv+ + + ++++k nl+a+ G + +g++lsGht lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4519 1 VRMNTVSHHSNLELIHFIRDHLAKLGVKSRL-TFNEDKTKANLFATLGEGK-PAGIILSGHT 60 6799***********************9765.566666**********777.89******** PP TIGR01892 69 DvvPvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaD 130 D+vP d++ Wt Dp+ +kdg LYgrG+aDmk F+ +++ + + + +hl++s++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4519 61 DTVPWDGQDWTMDPLSALVKDGNLYGRGSADMKAFIGIAVSHAEQFLHSDAPFAIHLAFSYE 122 ****************************************99999999999999******** PP TIGR01892 131 eevglaGakklieala...rrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrG 189 ee+g+ G+k+li+ l +p ivGePts+v+ ahkG k vrG+e+hss + + lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4519 123 EEIGCFGVKELIADLRdanIKPLACIVGEPTSMVPAIAHKGVYRYKCCVRGKEAHSSLTPHS 184 *************9988889****************************************** PP TIGR01892 190 vsaielaakllarlvaladklkr.edleeaFtppyatlniGtvkGGkavniiaaaCelvlel 250 v+aie+aa++++r+ ++a+ ++ e+ e+F++p++t +G+ +GG a n++++ e+ e+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4519 185 VNAIEMAARVVGRVRDMAEGFEKnEPRFEGFDVPFSTSSVGQFHGGIADNVVPRDAEFRYEF 246 *********************9967788********************************** PP TIGR01892 251 RpipGmdpeellallekiaee....vkekapgfevkveelsatpaleleedaelvallekla 308 R +p + ++++a++ + a++ +k+ ap+ + e+ +p++ +d ++ +l+++l+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4519 247 RDLPTANAAQMQAEVVAYAKSlepaMKKVAPAAGFAFETICEIPSFLGSKDDPVTRLAQELS 308 *************99998887667788999******************************** PP TIGR01892 309 Ga.aaevvsygteagllqelGieavvlGPGdidqahqpdeYveieelkrcraller 363 G+ ++ v++gteagl++++Gi++vv+GPG+i+qahqpdeYv +e+l rc+a+++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4519 309 GEkSTTLVAFGTEAGLFKNAGISTVVCGPGSIQQAHQPDEYVSLEQLARCEAFMQG 364 **78899**********************************************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (372 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.84 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory