GapMind for Amino acid biosynthesis

 

Alignments for a candidate for thrB in Acidovorax sp. GW101-3H11

Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (characterized)
to candidate Ac3H11_1651 Homoserine kinase (EC 2.7.1.39)

Query= SwissProt::P29364
         (316 letters)



>FitnessBrowser__acidovorax_3H11:Ac3H11_1651
          Length = 316

 Score =  209 bits (531), Expect = 9e-59
 Identities = 127/318 (39%), Positives = 170/318 (53%), Gaps = 10/318 (3%)

Query: 1   MSVFTPLERSTLEAFLAPYDLGRLRDFRGIAEGSENSNFFVSLEHGEFVLTLVERGPVQD 60
           M+VFT +  +     L    LG L + RGI  G EN+N+F++ + G FVLTL ER   + 
Sbjct: 1   MAVFTEVSNTEARELLRRLQLGELVELRGIEGGIENTNYFLTSDQGAFVLTLFERLTAEQ 60

Query: 61  LPFFIELLDVLHEDGLPVPYALRTRDGEALRRLEGKPALLQPRLAGRHERQPNAHHCQEV 120
           LPF++ L+  L   G+PVP     ++G+ L  + GKPA +  +L G+ +  P   HC  V
Sbjct: 61  LPFYLYLMKHLAHGGVPVPDPRADKNGDILHTVCGKPAAVVNKLRGKSQLAPQGAHCAAV 120

Query: 121 GDLLGHLHAATRGRILERPSDRGLPWMLEQGANLAPRLPEQARALLAPALA--EIAALDA 178
           G +L  +H A R     +P+ RGLPW  E    + P + E   ALL   LA     A  +
Sbjct: 121 GTMLARMHLAGRDFDRRQPNLRGLPWWNETVPVVLPHIGEAQSALLRAELAYQNHVAAGS 180

Query: 179 ERPALPRANLHADLFRDNVLFDGPHLAGLIDFYNACSGWMLYDLAITLNDWCSN-TDGSL 237
              ALP   +HADLFRDNV+F+G  L G  DFY A     L+DLA+ LNDWC +   G+ 
Sbjct: 181 AYAALPCGPVHADLFRDNVMFEGEELTGFFDFYFAGVDTWLFDLAVCLNDWCIDLPTGAH 240

Query: 238 DPARARALLAAYANRRPFTALEAEHWPSMLRVACVRFWLSRL----IAAEAFAGQDVLIH 293
           D  RA  +L AY   RP TA E E  P+MLR   +RFW+SRL    +  EA     +  H
Sbjct: 241 DAERATRMLDAYQAVRPLTAAERELLPAMLRAGALRFWISRLWDFYLPREA---SMLTPH 297

Query: 294 DPAEFEIRLAQRQNVEIH 311
           DP  FE  L  R    +H
Sbjct: 298 DPTHFERVLRHRVAHPVH 315


Lambda     K      H
   0.324    0.140    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 272
Number of extensions: 12
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 316
Length of database: 316
Length adjustment: 27
Effective length of query: 289
Effective length of database: 289
Effective search space:    83521
Effective search space used:    83521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 48 (23.1 bits)

Align candidate Ac3H11_1651 (Homoserine kinase (EC 2.7.1.39))
to HMM TIGR00938 (thrB: homoserine kinase (EC 2.7.1.39))

Software error:

../bin/blast/fastacmd -i /tmp/list.24250.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.24250.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.