GapMind for Amino acid biosynthesis

 

Alignments for a candidate for thrB in Acidovorax sp. GW101-3H11

Align Homoserine kinase (EC:2.7.1.39) (characterized)
to candidate Ac3H11_3449 Shikimate kinase I (EC 2.7.1.71)

Query= reanno::Miya:8500213
         (185 letters)



>FitnessBrowser__acidovorax_3H11:Ac3H11_3449
          Length = 180

 Score = 81.6 bits (200), Expect = 7e-21
 Identities = 51/145 (35%), Positives = 79/145 (54%), Gaps = 4/145 (2%)

Query: 22  SIIGMAGAGKTTVGRELALQLGWAHVDTDNLIEATYGTRLQAVADSMDKESFLDVEAGVI 81
           +++GM G+GK+TVGR+LA + G   +D D+ +E T GT +++  ++  +  F D+EA V+
Sbjct: 6   ALVGMPGSGKSTVGRQLAHRAGVPFIDLDHRLEQTLGTTIRSFFEAEGEARFRDIEAQVL 65

Query: 82  RRIGAR--RTVLSTGGSVVYRHEAMAHLAALGPLVYLDVSLPLILKRIAMNPDRGLAIA- 138
             +  +    VLSTGG  V R E    L   G ++YL  S   I KR+  +  R L    
Sbjct: 66  ADVARQPGGMVLSTGGGAVLRPENREVLRQFGNVLYLRASPEEIFKRVKHDKTRPLLQGG 125

Query: 139 -PGQTIEDLYNERIALYRRYATFTV 162
            P   + DLY +R  LYR  A + +
Sbjct: 126 NPMDKLRDLYAQRDHLYRETAHYVI 150


Lambda     K      H
   0.321    0.137    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 103
Number of extensions: 5
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 185
Length of database: 180
Length adjustment: 19
Effective length of query: 166
Effective length of database: 161
Effective search space:    26726
Effective search space used:    26726
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 44 (21.6 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory