Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate Ac3H11_1534 Tryptophan synthase beta chain (EC 4.2.1.20)
Query= uniprot:P50383 (425 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1534 Length = 425 Score = 123 bits (308), Expect = 1e-32 Identities = 112/357 (31%), Positives = 165/357 (46%), Gaps = 36/357 (10%) Query: 72 IGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAKEEGIEHVVTET 131 +GRP+P++ A R L A+IY K E TG+HKIN I QA A+ G V+ ET Sbjct: 57 VGRPSPVYHAARTSRELGG-AQIYLKREDLNHTGAHKINNVIGQAMLARRMGKPRVIAET 115 Query: 132 GAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYASPTNLTEYGRKI 191 GAGQ G A A + Y ++ ++M +++ M+L GA V E G K Sbjct: 116 GAGQHGVATATICARYGLECVVYMGSEDVKRQSPNVFRMKLLGATVVP-----VESGSKT 170 Query: 192 LETNPQHPGSLGIAMSEAIEYALKNEFRYLVGSVLD------VVLLHQSVIGQETITQL- 244 L+ +L AM + + + N F Y++G+V +V QSVIG+E+I Q+ Sbjct: 171 LK------DALNEAMRDWVA-NVDNTF-YIIGTVAGPHPYPMMVRDFQSVIGKESIEQMP 222 Query: 245 ------DLLGEDADILIGCVGGGSNFGGFTYPFIGNKKGKRYIAVSSAEIPKFSKGEYKY 298 + E D +I CVGGGSN G +P+I K R I V +A G++ Sbjct: 223 AMLAEQKIAAEQPDAVIACVGGGSNAMGIFHPYIPFAK-TRLIGVEAAG-EGLDSGKHSA 280 Query: 299 DFP-DSAGLLPLVKMITL---GKDYVPPPIYAGGLRYHGVAPTLSLLTKEGIVEWREYNE 354 S+G+L + L + GL Y GV P + L + G E+ + Sbjct: 281 SLQRGSSGVLHGNRTFILQDANGQITETHSISAGLDYPGVGPEHAWLQEIGRAEYVGITD 340 Query: 355 REIFEAAKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERKVIVFNLSGHGLLDL 411 +E A +GI+PA ES+HA + A R + + I+ NLSG G D+ Sbjct: 341 QEALSAFHHLCRTEGIIPALESSHAFAYALKLAPTMRPD---QAILVNLSGRGDKDI 394 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 425 Length adjustment: 32 Effective length of query: 393 Effective length of database: 393 Effective search space: 154449 Effective search space used: 154449 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate Ac3H11_1534 (Tryptophan synthase beta chain (EC 4.2.1.20))
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00263.hmm # target sequence database: /tmp/gapView.27630.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00263 [M=385] Accession: TIGR00263 Description: trpB: tryptophan synthase, beta subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-190 619.4 0.1 1.5e-190 619.2 0.1 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1534 Tryptophan synthase beta chain ( Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1534 Tryptophan synthase beta chain (EC 4.2.1.20) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 619.2 0.1 1.5e-190 1.5e-190 1 383 [. 11 399 .. 11 401 .. 0.97 Alignments for each domain: == domain 1 score: 619.2 bits; conditional E-value: 1.5e-190 TIGR00263 1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskk 62 g+fg +GG +v+e+l +a++el++ay ++++d++f++e+ + lk+++grp+p+++a++ s++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1534 11 GHFGPYGGSFVSETLTHAIQELRDAYARYQNDPDFVAEFAYELKHFVGRPSPVYHAARTSRE 72 68************************************************************ PP TIGR00263 63 lggakiylkredllhtGahkinnalgqallakrlGkkriiaetGaGqhGvatataaallgle 124 lgga+iylkredl+htGahkinn++gqa+la+r+Gk r+iaetGaGqhGvatat++a+ gle lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1534 73 LGGAQIYLKREDLNHTGAHKINNVIGQAMLARRMGKPRVIAETGAGQHGVATATICARYGLE 134 ************************************************************** PP TIGR00263 125 cevymGaedverqklnvfrmellgakvvpvtsGsktlkdavnealrdWvtsvedthyvlGsa 186 c+vymG+edv+rq++nvfrm+llga+vvpv+sGsktlkda+nea+rdWv++v++t+y++G++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1534 135 CVVYMGSEDVKRQSPNVFRMKLLGATVVPVESGSKTLKDALNEAMRDWVANVDNTFYIIGTV 196 ************************************************************** PP TIGR00263 187 vGphPfPeivrefqsvigeevkeqi......lekegrlPdaviacvGGGsnaiGifaafied 242 +GphP+P +vr+fqsvig+e eq+ ++ +++ PdaviacvGGGsna+Gif+++i lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1534 197 AGPHPYPMMVRDFQSVIGKESIEQMpamlaeQKIAAEQPDAVIACVGGGSNAMGIFHPYIPF 258 *********************99974333223334889************************ PP TIGR00263 243 eeveligveagGkGidtekhaatlskGkeGvlhGaktkllqdedGqieeahsvsaGldypgv 304 + +ligvea+G+G+d+ kh+a+l++G++GvlhG++t +lqd +Gqi+e+hs+saGldypgv lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1534 259 AKTRLIGVEAAGEGLDSGKHSASLQRGSSGVLHGNRTFILQDANGQITETHSISAGLDYPGV 320 ************************************************************** PP TIGR00263 305 gPehaalaetgraeyeaitdeealealkllskeeGiipalesshalaaleklapklkkdeiv 366 gPeha+l+e+graey+ itd+eal+a+++l+++eGiipalessha a++ klap+++ d+ + lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1534 321 GPEHAWLQEIGRAEYVGITDQEALSAFHHLCRTEGIIPALESSHAFAYALKLAPTMRPDQAI 382 ************************************************************** PP TIGR00263 367 vvnlsGrGdkdletvak 383 +vnlsGrGdkd+ tva+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1534 383 LVNLSGRGDKDIGTVAD 399 **************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (425 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.00 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory