Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate AZOBR_RS19025 AZOBR_RS19025 acetylornithine aminotransferase
Query= reanno::WCS417:GFF4238 (406 letters) >FitnessBrowser__azobra:AZOBR_RS19025 Length = 389 Score = 324 bits (830), Expect = 3e-93 Identities = 174/389 (44%), Positives = 236/389 (60%), Gaps = 5/389 (1%) Query: 16 VMVPNYAPAAFIPVRGEGSRVWDQAGRELIDFAGGIAVNVLGHAHPALVGALTEQAHKLW 75 V++P YA A + RGEG ++ GR +DFA G+AVNVLGHA+P LV ALT QAHKLW Sbjct: 4 VVMPTYARADIVFERGEGPYLYATDGRRFLDFAAGVAVNVLGHANPYLVEALTAQAHKLW 63 Query: 76 HVSNVFTNEPALRLAHKLIDATFAERVFFCNSGAEANEAAFKLARRVAFDRFGSEKYEII 135 H SN+F LA +L +ATFA+ VFF NSGAEA E KL R+ +++ + II Sbjct: 64 HTSNLFRVAGQESLAKRLTEATFADTVFFTNSGAEAWECGAKLIRKYHYEKGDKARTRII 123 Query: 136 AALNSFHGRTLFTVNVGGQSKYSDGFGPKITGITHVPYNDLDALKAAVSDKTCAVVLEPI 195 +FHGRTL V+ Q K GFGP + G VP+ DL+A++ AV+D+T + LEPI Sbjct: 124 TFEQAFHGRTLAAVSAAQQEKLIKGFGPLLDGFDLVPFGDLEAVRNAVTDETAGICLEPI 183 Query: 196 QGEGGVLPAELAYLQGARDLCDANNALLVFDEVQTGMGRSGHLFAYQHYGVTPDILTSAK 255 QGEGG+ + +L+G R++CD + LL DE+Q GMGR+G LFA++ G+TPD++ AK Sbjct: 184 QGEGGIRAGSVEFLRGLREICDEHGLLLFLDEIQCGMGRTGKLFAHEWAGITPDVMAVAK 243 Query: 256 SLGGGFPIAAMLTTEALAKHLVVGTHGTTYGGNPLACAVAEAVIDVINTPEVLAGVNAKH 315 +GGGFP+ A L TE A + GTHG+TYGGNPLA AV AV+D + P L V Sbjct: 244 GIGGGFPLGACLATEKAASGMTAGTHGSTYGGNPLATAVGNAVLDKVLEPGFLDHVQRIG 303 Query: 316 DLFKARLE-QIGKQYGIFTEVRGMGLLLGCVLSDAFKGKAKDVFNAAEKENLMILQAGPD 374 L + RL + + +F VRG GL+LG A DV A L+ + AG + Sbjct: 304 GLLQDRLAGLVAENPAVFKGVRGKGLMLGLACGPA----VGDVVVALRANGLLSVPAGDN 359 Query: 375 VVRFAPSLVVEDADIKEGLDRFERAVKAL 403 VVR P L + +A+++E + + K L Sbjct: 360 VVRLLPPLNIGEAEVEEAVAILAKTAKEL 388 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 418 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 389 Length adjustment: 31 Effective length of query: 375 Effective length of database: 358 Effective search space: 134250 Effective search space used: 134250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory