GapMind for Amino acid biosynthesis

 

Aligments for a candidate for aroC in Azospirillum brasilense Sp245

Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate AZOBR_RS10730 AZOBR_RS10730 chorismate synthase

Query= SwissProt::P12008
         (361 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS10730 AZOBR_RS10730 chorismate
           synthase
          Length = 358

 Score =  447 bits (1149), Expect = e-130
 Identities = 223/356 (62%), Positives = 277/356 (77%), Gaps = 9/356 (2%)

Query: 1   MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR 60
           MAGN+ G LFR TT+GESHG A+G +VDG P  + LTEAD+Q  LD+RRPG SRYTTQR+
Sbjct: 1   MAGNSFGTLFRFTTWGESHGPAIGVVVDGCPSLLSLTEADIQPWLDKRRPGQSRYTTQRQ 60

Query: 61  EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY 120
           EPDQV+ILSGVFEG TTGT + L+IENTDQRS+DYS I   FRPGHADYTY +KYG+RDY
Sbjct: 61  EPDQVRILSGVFEGRTTGTPVSLMIENTDQRSKDYSEIASKFRPGHADYTYWKKYGIRDY 120

Query: 121 RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIK--DWSQVEQNPF 178
           RGGGRSSARETA RVAAGA+A+K L +  G+ +RG L Q+G   +D    DW++V+ NPF
Sbjct: 121 RGGGRSSARETACRVAAGAVARKVLGD--GVTVRGALVQIGPHKVDRSRWDWAEVDNNPF 178

Query: 179 FCPDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSIN 238
           FCPDP       + +  ++K G SIGA V VVASG+PAGLG+P++D+LD D+AHA+M+IN
Sbjct: 179 FCPDPQAAAEWADYLDGIRKSGSSIGAVVEVVASGLPAGLGDPLYDKLDGDLAHAMMTIN 238

Query: 239 AVKGVEIGDGFDVVALRGSQNRDEIT--KDG---FQSNHAGGILGGISSGQQIIAHMALK 293
           AVKGVEIG+GF+   L G QN DE+    DG   F+SN AGGILGGIS+GQ ++   A+K
Sbjct: 239 AVKGVEIGNGFEAATLTGEQNADEMRAGPDGEPEFRSNLAGGILGGISTGQDVVVRFAVK 298

Query: 294 PTSSITVPGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRA 349
           PTSSI  P +T++  G++ +++TKGRHDPCVGIRAVP+ EAM+A VL DHLLR RA
Sbjct: 299 PTSSILTPRQTVDLQGKDTDILTKGRHDPCVGIRAVPVGEAMMACVLADHLLRHRA 354


Lambda     K      H
   0.319    0.138    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 461
Number of extensions: 21
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 361
Length of database: 358
Length adjustment: 29
Effective length of query: 332
Effective length of database: 329
Effective search space:   109228
Effective search space used:   109228
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

Align candidate AZOBR_RS10730 AZOBR_RS10730 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00033.hmm
# target sequence database:        /tmp/gapView.23973.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00033  [M=351]
Accession:   TIGR00033
Description: aroC: chorismate synthase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   7.3e-143  461.7   0.0   8.3e-143  461.5   0.0    1.0  1  lcl|FitnessBrowser__azobra:AZOBR_RS10730  AZOBR_RS10730 chorismate synthas


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__azobra:AZOBR_RS10730  AZOBR_RS10730 chorismate synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  461.5   0.0  8.3e-143  8.3e-143       1     349 [.      10     354 ..      10     356 .. 0.99

  Alignments for each domain:
  == domain 1  score: 461.5 bits;  conditional E-value: 8.3e-143
                                 TIGR00033   1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 
                                               +r+tt+GeSHg+a+g+++dG+P+ l+lte+diq+ l++Rrpgqsr+t++r+E D+v+ilsGvfeG+TtG
  lcl|FitnessBrowser__azobra:AZOBR_RS10730  10 FRFTTWGESHGPAIGVVVDGCPSLLSLTEADIQPWLDKRRPGQSRYTTQRQEPDQVRILSGVFEGRTTG 78 
                                               89******************************************************************* PP

                                 TIGR00033  70 aPiallikNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLke 138
                                               +P++l+i+N+d+rskdy++i++++RPgHadyty+kKYgi+d++gggrsSaReTa+rvaaGava+k L +
  lcl|FitnessBrowser__azobra:AZOBR_RS10730  79 TPVSLMIENTDQRSKDYSEIASKFRPGHADYTYWKKYGIRDYRGGGRSSARETACRVAAGAVARKVLGD 147
                                               *******************************************************************99 PP

                                 TIGR00033 139 tagieivayvvklgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvv 207
                                                 g+ + + +v++g  +++++  +     ++d++p++cpd++a++e  +++d ++k+g s+G+vvevv+
  lcl|FitnessBrowser__azobra:AZOBR_RS10730 148 --GVTVRGALVQIGPHKVDRSRWD---WAEVDNNPFFCPDPQAAAEWADYLDGIRKSGSSIGAVVEVVA 211
                                               ..9****************98887...479*************************************** PP

                                 TIGR00033 208 snvpvglGeplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvle.ddkirrktnnsGG 275
                                               s++p+glG+pl+dkld+ la+a+++inAvKgveiG+GFeaa+ +G +  De+ +  d++ ++++n  GG
  lcl|FitnessBrowser__azobra:AZOBR_RS10730 212 SGLPAGLGDPLYDKLDGDLAHAMMTINAVKGVEIGNGFEAATLTGEQNADEMRAGpDGEPEFRSNLAGG 280
                                               ******************************************************99999********** PP

                                 TIGR00033 276 ieGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcvvpravpvvEamvalvladal 344
                                               i+GGi++G+d++vr avKp+++i +p++tvdl++k++   tkgRhDpcv +ravpv Eam+a vlad+l
  lcl|FitnessBrowser__azobra:AZOBR_RS10730 281 ILGGISTGQDVVVRFAVKPTSSILTPRQTVDLQGKDTDILTKGRHDPCVGIRAVPVGEAMMACVLADHL 349
                                               ********************************************************************* PP

                                 TIGR00033 345 lekra 349
                                               l++ra
  lcl|FitnessBrowser__azobra:AZOBR_RS10730 350 LRHRA 354
                                               **986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (351 nodes)
Target sequences:                          1  (358 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 9.34
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory