Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate AZOBR_RS10730 AZOBR_RS10730 chorismate synthase
Query= SwissProt::P12008 (361 letters) >lcl|FitnessBrowser__azobra:AZOBR_RS10730 AZOBR_RS10730 chorismate synthase Length = 358 Score = 447 bits (1149), Expect = e-130 Identities = 223/356 (62%), Positives = 277/356 (77%), Gaps = 9/356 (2%) Query: 1 MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR 60 MAGN+ G LFR TT+GESHG A+G +VDG P + LTEAD+Q LD+RRPG SRYTTQR+ Sbjct: 1 MAGNSFGTLFRFTTWGESHGPAIGVVVDGCPSLLSLTEADIQPWLDKRRPGQSRYTTQRQ 60 Query: 61 EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY 120 EPDQV+ILSGVFEG TTGT + L+IENTDQRS+DYS I FRPGHADYTY +KYG+RDY Sbjct: 61 EPDQVRILSGVFEGRTTGTPVSLMIENTDQRSKDYSEIASKFRPGHADYTYWKKYGIRDY 120 Query: 121 RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIK--DWSQVEQNPF 178 RGGGRSSARETA RVAAGA+A+K L + G+ +RG L Q+G +D DW++V+ NPF Sbjct: 121 RGGGRSSARETACRVAAGAVARKVLGD--GVTVRGALVQIGPHKVDRSRWDWAEVDNNPF 178 Query: 179 FCPDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSIN 238 FCPDP + + ++K G SIGA V VVASG+PAGLG+P++D+LD D+AHA+M+IN Sbjct: 179 FCPDPQAAAEWADYLDGIRKSGSSIGAVVEVVASGLPAGLGDPLYDKLDGDLAHAMMTIN 238 Query: 239 AVKGVEIGDGFDVVALRGSQNRDEIT--KDG---FQSNHAGGILGGISSGQQIIAHMALK 293 AVKGVEIG+GF+ L G QN DE+ DG F+SN AGGILGGIS+GQ ++ A+K Sbjct: 239 AVKGVEIGNGFEAATLTGEQNADEMRAGPDGEPEFRSNLAGGILGGISTGQDVVVRFAVK 298 Query: 294 PTSSITVPGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRA 349 PTSSI P +T++ G++ +++TKGRHDPCVGIRAVP+ EAM+A VL DHLLR RA Sbjct: 299 PTSSILTPRQTVDLQGKDTDILTKGRHDPCVGIRAVPVGEAMMACVLADHLLRHRA 354 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 461 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 358 Length adjustment: 29 Effective length of query: 332 Effective length of database: 329 Effective search space: 109228 Effective search space used: 109228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate AZOBR_RS10730 AZOBR_RS10730 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.23973.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-143 461.7 0.0 8.3e-143 461.5 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS10730 AZOBR_RS10730 chorismate synthas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS10730 AZOBR_RS10730 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 461.5 0.0 8.3e-143 8.3e-143 1 349 [. 10 354 .. 10 356 .. 0.99 Alignments for each domain: == domain 1 score: 461.5 bits; conditional E-value: 8.3e-143 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 +r+tt+GeSHg+a+g+++dG+P+ l+lte+diq+ l++Rrpgqsr+t++r+E D+v+ilsGvfeG+TtG lcl|FitnessBrowser__azobra:AZOBR_RS10730 10 FRFTTWGESHGPAIGVVVDGCPSLLSLTEADIQPWLDKRRPGQSRYTTQRQEPDQVRILSGVFEGRTTG 78 89******************************************************************* PP TIGR00033 70 aPiallikNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLke 138 +P++l+i+N+d+rskdy++i++++RPgHadyty+kKYgi+d++gggrsSaReTa+rvaaGava+k L + lcl|FitnessBrowser__azobra:AZOBR_RS10730 79 TPVSLMIENTDQRSKDYSEIASKFRPGHADYTYWKKYGIRDYRGGGRSSARETACRVAAGAVARKVLGD 147 *******************************************************************99 PP TIGR00033 139 tagieivayvvklgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvv 207 g+ + + +v++g +++++ + ++d++p++cpd++a++e +++d ++k+g s+G+vvevv+ lcl|FitnessBrowser__azobra:AZOBR_RS10730 148 --GVTVRGALVQIGPHKVDRSRWD---WAEVDNNPFFCPDPQAAAEWADYLDGIRKSGSSIGAVVEVVA 211 ..9****************98887...479*************************************** PP TIGR00033 208 snvpvglGeplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvle.ddkirrktnnsGG 275 s++p+glG+pl+dkld+ la+a+++inAvKgveiG+GFeaa+ +G + De+ + d++ ++++n GG lcl|FitnessBrowser__azobra:AZOBR_RS10730 212 SGLPAGLGDPLYDKLDGDLAHAMMTINAVKGVEIGNGFEAATLTGEQNADEMRAGpDGEPEFRSNLAGG 280 ******************************************************99999********** PP TIGR00033 276 ieGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcvvpravpvvEamvalvladal 344 i+GGi++G+d++vr avKp+++i +p++tvdl++k++ tkgRhDpcv +ravpv Eam+a vlad+l lcl|FitnessBrowser__azobra:AZOBR_RS10730 281 ILGGISTGQDVVVRFAVKPTSSILTPRQTVDLQGKDTDILTKGRHDPCVGIRAVPVGEAMMACVLADHL 349 ********************************************************************* PP TIGR00033 345 lekra 349 l++ra lcl|FitnessBrowser__azobra:AZOBR_RS10730 350 LRHRA 354 **986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (358 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.34 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory