GapMind for Amino acid biosynthesis

 

Alignments for a candidate for aroC in Azospirillum brasilense Sp245

Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate AZOBR_RS10730 AZOBR_RS10730 chorismate synthase

Query= SwissProt::P12008
         (361 letters)



>FitnessBrowser__azobra:AZOBR_RS10730
          Length = 358

 Score =  447 bits (1149), Expect = e-130
 Identities = 223/356 (62%), Positives = 277/356 (77%), Gaps = 9/356 (2%)

Query: 1   MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR 60
           MAGN+ G LFR TT+GESHG A+G +VDG P  + LTEAD+Q  LD+RRPG SRYTTQR+
Sbjct: 1   MAGNSFGTLFRFTTWGESHGPAIGVVVDGCPSLLSLTEADIQPWLDKRRPGQSRYTTQRQ 60

Query: 61  EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY 120
           EPDQV+ILSGVFEG TTGT + L+IENTDQRS+DYS I   FRPGHADYTY +KYG+RDY
Sbjct: 61  EPDQVRILSGVFEGRTTGTPVSLMIENTDQRSKDYSEIASKFRPGHADYTYWKKYGIRDY 120

Query: 121 RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIK--DWSQVEQNPF 178
           RGGGRSSARETA RVAAGA+A+K L +  G+ +RG L Q+G   +D    DW++V+ NPF
Sbjct: 121 RGGGRSSARETACRVAAGAVARKVLGD--GVTVRGALVQIGPHKVDRSRWDWAEVDNNPF 178

Query: 179 FCPDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSIN 238
           FCPDP       + +  ++K G SIGA V VVASG+PAGLG+P++D+LD D+AHA+M+IN
Sbjct: 179 FCPDPQAAAEWADYLDGIRKSGSSIGAVVEVVASGLPAGLGDPLYDKLDGDLAHAMMTIN 238

Query: 239 AVKGVEIGDGFDVVALRGSQNRDEIT--KDG---FQSNHAGGILGGISSGQQIIAHMALK 293
           AVKGVEIG+GF+   L G QN DE+    DG   F+SN AGGILGGIS+GQ ++   A+K
Sbjct: 239 AVKGVEIGNGFEAATLTGEQNADEMRAGPDGEPEFRSNLAGGILGGISTGQDVVVRFAVK 298

Query: 294 PTSSITVPGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRA 349
           PTSSI  P +T++  G++ +++TKGRHDPCVGIRAVP+ EAM+A VL DHLLR RA
Sbjct: 299 PTSSILTPRQTVDLQGKDTDILTKGRHDPCVGIRAVPVGEAMMACVLADHLLRHRA 354


Lambda     K      H
   0.319    0.138    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 461
Number of extensions: 21
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 361
Length of database: 358
Length adjustment: 29
Effective length of query: 332
Effective length of database: 329
Effective search space:   109228
Effective search space used:   109228
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

Align candidate AZOBR_RS10730 AZOBR_RS10730 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))

Software error:

../bin/blast/fastacmd -i /tmp/list.11902.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.11902.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.