GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asd in Azospirillum brasilense Sp245

Align Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 (characterized)
to candidate AZOBR_RS14735 AZOBR_RS14735 aspartate-semialdehyde dehydrogenase

Query= SwissProt::P23247
         (337 letters)



>FitnessBrowser__azobra:AZOBR_RS14735
          Length = 337

 Score =  258 bits (660), Expect = 1e-73
 Identities = 149/331 (45%), Positives = 206/331 (62%), Gaps = 12/331 (3%)

Query: 7   VAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYR--FNGKTVRVQNVEEFDW 64
           VAI GATGAVG  M++VL  R FPV EL L ASERS G+T    F  KT+   +VE+   
Sbjct: 11  VAIVGATGAVGREMVDVLHRRSFPVAELGLFASERSAGRTVETPFGEKTLVAFDVEKV-- 68

Query: 65  SQVHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAEFRNR 124
               I L +  G+ + + AP  A  G +VIDN+S FRYD ++PL+VPE+N  A+ + +  
Sbjct: 69  KGYDIVLLAVSGDFAKEHAPAIAAGGALVIDNSSAFRYDDNVPLIVPEINAHAMGDAK-- 126

Query: 125 NIIANPNCSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNGYP 184
            +IANPNC+T   +VAL P++ A G++R+ V+TYQ+ SGAG  G+ EL  QT   L+G P
Sbjct: 127 -LIANPNCTTAIAVVALGPLHKAFGLKRVIVSTYQATSGAGAEGMAELEEQTRNQLDGKP 185

Query: 185 AETNTFSQQIAFNCIPQIDQFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYG 244
              + F   I FN IPQID F +NGYTKEEMK+ WET+KI   P + V+ T VR+P +  
Sbjct: 186 VVNSVFRHPIPFNLIPQIDAFQENGYTKEEMKVTWETRKILEIPDLPVSCTAVRIPTYRA 245

Query: 245 HAEAVHVETRAPIDAEQVMDMLEQTDGI---ELFRGADFPTQVRDAGGKDHVLVGRVRND 301
           H+EA+ VET +P+  +    +L    G+   ++     +P  + +A G+  V VGR+R  
Sbjct: 246 HSEAITVETLSPVTPDAARAVLADAPGVVVKDVPADGVYPMPL-NATGQFDVEVGRIRTS 304

Query: 302 -ISHHSGINLWVVADNVRKGAATNAVQIAEL 331
            I    G++L+V  D + KGAA NAVQIAEL
Sbjct: 305 LIFGDHGLDLFVCGDQLLKGAALNAVQIAEL 335


Lambda     K      H
   0.319    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 300
Number of extensions: 7
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 337
Length of database: 337
Length adjustment: 28
Effective length of query: 309
Effective length of database: 309
Effective search space:    95481
Effective search space used:    95481
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate AZOBR_RS14735 AZOBR_RS14735 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))

Software error:

../bin/blast/fastacmd -i /tmp/list.14477.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.14477.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.