Align [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase (EC 2.5.1.113); O-phosphoserine sulfhydrylase (EC 2.5.1.65) (characterized)
to candidate AZOBR_RS08705 AZOBR_RS08705 cysteine synthase
Query= BRENDA::P9WP53 (323 letters) >FitnessBrowser__azobra:AZOBR_RS08705 Length = 334 Score = 138 bits (347), Expect = 2e-37 Identities = 106/314 (33%), Positives = 152/314 (48%), Gaps = 31/314 (9%) Query: 10 ALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAEADGLLR 69 ++GNTPL+ L+ S + K E NP GS+KDR A+ ++ AE GLLR Sbjct: 10 SIGNTPLIRLEGPSK-------ATGCEILGKAEFLNPGGSVKDRAALAIVRDAERRGLLR 62 Query: 70 PGATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQIIFSAAEGGS 129 PG TI+E T+GNTGI LA+ GYR + VMPE S E++ +L L GA + A S Sbjct: 63 PGGTIVEGTAGNTGIGLALVGNALGYRTVIVMPETQSQEKKDMLRLIGADLRLVPAVPYS 122 Query: 130 NT------AVATAKELAATNPSW-VMLYQYGNPANTDSHYCGTGPELLADLP-EITHFVA 181 N + A+ELA T P+ V Q+ N AN + H TGPE+ I F Sbjct: 123 NPDNYVRYSGRLAEELAKTEPNGAVWANQFDNVANREGHRLTTGPEIWTQTEGRIDAFTC 182 Query: 182 GLGTTGTLMGTGRFLREHVANVKIVAAEPR----YGEGVYALRNMDEGFVPELYDPEILT 237 +G+ GTL G G L+E +V+IV A+P Y + + + E +T Sbjct: 183 AVGSGGTLAGVGLALKERNPDVRIVLADPMGASLYHHYAHGTLKAEGSSITEGIGQGRIT 242 Query: 238 ARYSVGAVD-AVRRTRE--------LVHTEGIFAGISTGAVLHAALGVGAGALAAGERAD 288 A VD A++ T E L+ ++G+ G S+G + AA+ + A G Sbjct: 243 ANLEGAPVDQALQITDEEALPVIFDLIKSQGLVLGGSSGINIAAAIRI---AKEMGPGHT 299 Query: 289 IALVVADAGWKYLS 302 I ++ D G +Y S Sbjct: 300 IVTILCDGGQRYQS 313 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 334 Length adjustment: 28 Effective length of query: 295 Effective length of database: 306 Effective search space: 90270 Effective search space used: 90270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory