Align alanine-glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate AZOBR_RS07830 AZOBR_RS07830 aminotransferase
Query= BRENDA::D2Z0I0 (402 letters) >FitnessBrowser__azobra:AZOBR_RS07830 Length = 424 Score = 414 bits (1063), Expect = e-120 Identities = 207/390 (53%), Positives = 270/390 (69%), Gaps = 4/390 (1%) Query: 7 FPKVKKLPKYVFAMVNELKYQLRREGEDIVDLGMGNPDIPPSQHIIDKLCEVANRPNVHG 66 F ++K+LP YVFA VN +K + R GEDI+DLGMGNPD P QHI+DKL E P H Sbjct: 6 FHRIKRLPPYVFAEVNAMKARARAAGEDIIDLGMGNPDQPTPQHIVDKLIEAVRDPKTHR 65 Query: 67 YSASKGIPRLRKAICDFYKRRYGVELDPERNAIMTIGAKEGYSHLMLAMLEPGDTVIVPN 126 YS S+GIP LRKA +YKRR+ V++DPE I+TIG+KEG ++L A+ PGD ++VPN Sbjct: 66 YSNSRGIPGLRKAHAAYYKRRFNVDVDPESECIVTIGSKEGLANLAQAITSPGDIILVPN 125 Query: 127 PTYPIHYYAPIICGGDAISVPILPEEDFP---EVFLRRLYDLIKTSFRKPKAVVLSFPHN 183 P+YPIH + I+ G +P+ + F+ L ++ S KP A+VL++P N Sbjct: 126 PSYPIHPFGFILAGASVRHLPVGQANGTSTDIDSFMIMLERAVRHSVPKPLALVLNYPSN 185 Query: 184 PTTLCVDLEFFQEVVKLAKQEGIWIVHDFAYADLGFDGYTPPSILQVEGALDVAVELYSM 243 PT V L+F++ +V+ ++ GI+I+ D AYA++ FDG PPSIL++ A +VAVE SM Sbjct: 186 PTAEVVGLDFYRPIVEFCRKHGIYILSDLAYAEVFFDGEPPPSILEIPEAREVAVEFTSM 245 Query: 244 SKGFSMAGWRVAFVVGNEMLIKNLAHLKSYLDYGVFTPIQVASIIALESPYEVVEKNREI 303 SK +SMAGWR+ F GN+ LI LA +KSYLDYG FTPIQVA+ AL P E VE+ R + Sbjct: 246 SKTYSMAGWRIGFATGNKKLITALARIKSYLDYGAFTPIQVAATAALNGPQECVEQVRTM 305 Query: 304 YRRRRDVLVEGLNRVGWEVKKPKGSMFVWAKVPEEVG-MNSLDFSLFLLREAKVAVSPGI 362 YR+RRDV++EGL GW V P SMF WA +PE + SL+FS LL+EAKVAV+PGI Sbjct: 306 YRQRRDVMIEGLASAGWTVPSPSASMFAWAPIPEPFAHLGSLEFSKLLLQEAKVAVAPGI 365 Query: 363 GFGEYGEGYVRFALVENEHRIRQAVRGIKK 392 GFGEYG+G+VR ALVEN HRIRQA R IK+ Sbjct: 366 GFGEYGDGHVRLALVENVHRIRQATRNIKE 395 Lambda K H 0.322 0.141 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 477 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 424 Length adjustment: 31 Effective length of query: 371 Effective length of database: 393 Effective search space: 145803 Effective search space used: 145803 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory