Align Imidazoleglycerol-phosphate dehydratase; Short=IGPD; EC 4.2.1.19 (characterized, see rationale)
to candidate AZOBR_RS01665 AZOBR_RS01665 imidazoleglycerol-phosphate dehydratase
Query= uniprot:B2SZ63 (195 letters) >FitnessBrowser__azobra:AZOBR_RS01665 Length = 207 Score = 232 bits (592), Expect = 3e-66 Identities = 112/195 (57%), Positives = 144/195 (73%) Query: 1 MRLAEVVRNTSETQIRVKINLDGTGQQKLATGVPFLDHMLDQIARHGLFDLEIEAHGDLH 60 +R A + RNT+ET+IRV +NLDGTG + TGV FLDHML+Q++RH L DL + A GDLH Sbjct: 9 VRRASIERNTTETRIRVAVNLDGTGVYDVKTGVGFLDHMLEQLSRHSLMDLTVAAEGDLH 68 Query: 61 IDDHHTVEDTGITLGQAVAKAIGDRKGIVRYGHSYVPLDEALSRVVIDFSGRPGLEFHVP 120 ID HHT ED+GI +GQAVAKA+GDRKGI RYGH+Y+P+DE L+RV +DFS RP L + V Sbjct: 69 IDAHHTTEDSGIAIGQAVAKALGDRKGIQRYGHAYIPMDETLTRVALDFSNRPYLIWKVS 128 Query: 121 FTRARIGTFDVDLSIEFFRGFVNHAGVTLHIDNLRGLNAHHQMETVFKAFGRALRMATEL 180 F+R +IG D +L E+F+ F AGVTLH++ L G N HH +E+ +KA RALR E+ Sbjct: 129 FSRDKIGDMDTELFREWFQAFAMAAGVTLHVECLYGENNHHIVESCYKALARALRAGIEI 188 Query: 181 DERAAGQIPSTKGSL 195 D R +PSTKG+L Sbjct: 189 DPRKRDAVPSTKGTL 203 Lambda K H 0.323 0.140 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 195 Length of database: 207 Length adjustment: 21 Effective length of query: 174 Effective length of database: 186 Effective search space: 32364 Effective search space used: 32364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory