Align Ribose-phosphate pyrophosphokinase; RPPK; EC 2.7.6.1; 5-phospho-D-ribosyl alpha-1-diphosphate; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase (uncharacterized)
to candidate AZOBR_RS06995 AZOBR_RS06995 ribose-phosphate pyrophosphokinase
Query= curated2:Q8TUT6 (291 letters) >FitnessBrowser__azobra:AZOBR_RS06995 Length = 297 Score = 142 bits (357), Expect = 1e-38 Identities = 99/278 (35%), Positives = 140/278 (50%), Gaps = 7/278 (2%) Query: 14 RRLAEELDAELAPVEEDRFPDGEQIVRVPPELDGTVVVVHSMSPPQDENLVKAIITLDAA 73 RRLAE L+ E RFPDGE +VR+P ++ VV S+ P D+ LV+ + Sbjct: 18 RRLAEALNVPCHIAELHRFPDGESLVRLPEAVE-RAVVYRSLDRPNDK-LVELTLAASVL 75 Query: 74 RENGAEEVIAIVPYMAYSRQDRRFEPGEPVSFRAVARAVSANADALITVD--LHEPGTLK 131 R +GA E+ + PYMAY RQD F PGEPVS V + D + V+ LH TL Sbjct: 76 RRHGATELCLVAPYMAYMRQDAVFRPGEPVSQAVVGDWLGRLFDRFVCVEPHLHRTHTLD 135 Query: 132 YFDV--PAENVSAAEELGKYLAERFEGEDLVVIGPDEGARELAREVASICGVEYDHLEKK 189 V P+ +S A + + L D V++GPDE A L VA G+ K+ Sbjct: 136 EVFVGRPSVCLSGAGAIAERLRRDGTAPDAVIVGPDEEAAPLVEVVAGPLGLTALVGRKE 195 Query: 190 RLSGDEVEIH-PKELDVEGRTVVLVDDMIDTGGTMVEAARALRDQGAGTLYAACTHALLT 248 R +V + P + + GR VV+VDD+I +G T+ ARA R GA ++ HAL Sbjct: 196 RRGDRDVTVTLPADAPLAGRPVVIVDDVISSGETIFSCARAARAAGAASVRVFGVHALFD 255 Query: 249 RNAATRLLASGFEDIIATDTVPNPFEKVSVAPPVAEAV 286 A R A G ++ D VP+P + +A +A+A+ Sbjct: 256 AAVAARFAAEGLGTPLSCDGVPHPSNDLPLARLIADAL 293 Lambda K H 0.314 0.134 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 297 Length adjustment: 26 Effective length of query: 265 Effective length of database: 271 Effective search space: 71815 Effective search space used: 71815 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
Align candidate AZOBR_RS06995 AZOBR_RS06995 (ribose-phosphate pyrophosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.29902.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-49 154.5 0.0 1.9e-49 154.2 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS06995 AZOBR_RS06995 ribose-phosphate p Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS06995 AZOBR_RS06995 ribose-phosphate pyrophosphokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 154.2 0.0 1.9e-49 1.9e-49 10 296 .. 14 294 .. 7 296 .. 0.92 Alignments for each domain: == domain 1 score: 154.2 bits; conditional E-value: 1.9e-49 TIGR01251 10 kelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmellllidalkra 78 + a+++a++l+++ +e ++F+dgE vr+ e+v +++++ s nd+l+el l+++ l+r lcl|FitnessBrowser__azobra:AZOBR_RS06995 14 ADGARRLAEALNVPCHIAELHRFPDGESLVRLPEAV---ERAVVYRSLD-RPNDKLVELTLAASVLRRH 78 5668999****************************9...6699966666.69***************** PP TIGR01251 79 saksvtaviPyygYaRqdkkaksrepisaklvaklleeaGadrvltvdlHseqiq...gfFd.vpvenl 143 +a ++ +v+Py++Y Rqd ++++ep+s +v++ l + dr + v+ H + ++ ++F p l lcl|FitnessBrowser__azobra:AZOBR_RS06995 79 GATELCLVAPYMAYMRQDAVFRPGEPVSQAVVGDWLGRL-FDRFVCVEPHLHRTHtldEVFVgRPSVCL 146 ***************************************.********99776542227787689999* PP TIGR01251 144 saspklieelkkke.lknlvvvsPDkGaverakkvakklglelaiieKeRdskenevevtnllgdvegk 211 s++ ++e+l+++ + + v+v PD+ a+ ++ va lgl + +KeR ++ + + + + ++g+ lcl|FitnessBrowser__azobra:AZOBR_RS06995 147 SGAGAIAERLRRDGtAPDAVIVGPDEEAAPLVEVVAGPLGLTALVGRKERRGDRDVTVTLPADAPLAGR 215 ***********998899**********************************888677778999****** PP TIGR01251 212 dvvivDDiisTggTlvkaaelLkekGAkkvivaathgvfsgdAlerlaeagveevivtntilveekklp 280 vvivDD+is+g T+ a++++ +GA +v v +h++f + r+a g+ + ++++ +++ lcl|FitnessBrowser__azobra:AZOBR_RS06995 216 PVVIVDDVISSGETIFSCARAARAAGAASVRVFGVHALFDAAVAARFAAEGLGTPLSCDGVPH------ 278 ***************************************************************...... PP TIGR01251 281 kvseisvapliaeaia 296 +++ +a lia+a++ lcl|FitnessBrowser__azobra:AZOBR_RS06995 279 PSNDLPLARLIADALL 294 7888889999998875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (297 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.45 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory