Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; Tetrahydrodipicolinate N-succinyltransferase; THDP succinyltransferase; THP succinyltransferase; Tetrahydropicolinate succinylase; EC 2.3.1.117 (characterized)
to candidate AZOBR_RS03475 AZOBR_RS03475 2 3 4 5-tetrahydropyridine-2 6-carboxylate N-succinyltransferase
Query= SwissProt::P56220 (274 letters) >FitnessBrowser__azobra:AZOBR_RS03475 Length = 280 Score = 334 bits (857), Expect = 1e-96 Identities = 173/275 (62%), Positives = 208/275 (75%), Gaps = 8/275 (2%) Query: 4 LQNVIESAFERRADITPANVDTVTREAVNQVIGLLDSGALRVAEKIDGQWVTHQWLKKAV 63 L++ + +A+E R D + R+AV + + LDSG LRVA+K D WV +QWLKKAV Sbjct: 6 LESAVNAAWETR-DTLNVSTKGAVRDAVEEALSGLDSGDLRVAQKTDAGWVVNQWLKKAV 64 Query: 64 LLSFRINDNKVMDGAE--TRYYDKVPMKFADYDEARFQKEGFRVVPPATVRQGAFIARNT 121 LLSFR+N N+ + GA +YDKVP KF + EA+FQ GFR VP A VR+ A++A N Sbjct: 65 LLSFRLNANETIPGAPGGASWYDKVPPKFEGWSEAQFQAAGFRAVPGAVVRRSAYVAPNV 124 Query: 122 VLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIEDN 181 +LMPS+VN+GAYVD GTMVDTW TVGSCAQIGKNVHLSGGVGIGGVLEPLQANP IIED+ Sbjct: 125 ILMPSFVNVGAYVDSGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIEDD 184 Query: 182 CFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGEIHYGRVPAGSVVVSGNLPSK 241 CF+GARSEVVEGVIVE G+V+SMGV++ ST+I DR TGE+ GRVPA SVVV G LP K Sbjct: 185 CFVGARSEVVEGVIVERGAVLSMGVFISASTKIIDRNTGEVFVGRVPAYSVVVPGTLPGK 244 Query: 242 ---DGS--YSLYCAVIVKKVDAKTRGKVGINELLR 271 DG+ LYCAVIVK+VD +TR K IN+LLR Sbjct: 245 PLPDGTPGPGLYCAVIVKRVDEQTRAKTSINDLLR 279 Lambda K H 0.318 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 280 Length adjustment: 25 Effective length of query: 249 Effective length of database: 255 Effective search space: 63495 Effective search space used: 63495 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate AZOBR_RS03475 AZOBR_RS03475 (2 3 4 5-tetrahydropyridine-2 6-carboxylate N-succinyltransferase)
to HMM TIGR00965 (dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00965.hmm # target sequence database: /tmp/gapView.619.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00965 [M=271] Accession: TIGR00965 Description: dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-131 424.1 0.1 1.4e-131 423.9 0.1 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS03475 AZOBR_RS03475 2 3 4 5-tetrahydro Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS03475 AZOBR_RS03475 2 3 4 5-tetrahydropyridine-2 6-carboxylate N-succinyltransfer # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 423.9 0.1 1.4e-131 1.4e-131 2 269 .. 6 279 .. 5 280 .] 0.94 Alignments for each domain: == domain 1 score: 423.9 bits; conditional E-value: 1.4e-131 TIGR00965 2 lqkiietaferraeilpasklikvkeavnesiasldsgalrvaekldgqwkvnewvkkavllsfritdn 70 l ++ a+e+r+ + ++ + v++av+e+++ ldsg lrva+k d+ w+vn+w+kkavllsfr++ n lcl|FitnessBrowser__azobra:AZOBR_RS03475 6 LESAVNAAWETRDTLNVST-KGAVRDAVEEALSGLDSGDLRVAQKTDAGWVVNQWLKKAVLLSFRLNAN 73 5667899****98776655.6789********************************************* PP TIGR00965 71 qvlnda..vnkyfdkvatkfadydedefkeaglrkvpgavvrrgafiaknvvlmpsyvnigayvdegtm 137 + + +a ++++dkv++kf ++e++f+ ag+r+vpgavvrr a++a nv+lmps+vn+gayvd gtm lcl|FitnessBrowser__azobra:AZOBR_RS03475 74 ETIPGApgGASWYDKVPPKFEGWSEAQFQAAGFRAVPGAVVRRSAYVAPNVILMPSFVNVGAYVDSGTM 142 ***88622689********************************************************** PP TIGR00965 138 vdtwatvgscaqigknvhlsggvgiggvleplqakpviiedncfigarseivegviveegsvismgvfi 206 vdtw tvgscaqigknvhlsggvgiggvleplqa+pviied+cf+garse+vegvive g+v+smgvfi lcl|FitnessBrowser__azobra:AZOBR_RS03475 143 VDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIEDDCFVGARSEVVEGVIVERGAVLSMGVFI 211 ********************************************************************* PP TIGR00965 207 gqstkivdretgeiiygrvpagsvvvsgslpsk...dgk..kslycavivkkvdaktrgkvsinellr 269 stki+dr+tge++ grvpa+svvv+g+lp k dg ++lycavivk+vd++tr+k+sin+llr lcl|FitnessBrowser__azobra:AZOBR_RS03475 212 SASTKIIDRNTGEVFVGRVPAYSVVVPGTLPGKplpDGTpgPGLYCAVIVKRVDEQTRAKTSINDLLR 279 ******************************9864457872258************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (271 nodes) Target sequences: 1 (280 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.81 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory