Align Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 (characterized)
to candidate AZOBR_RS12970 AZOBR_RS12970 aspartate aminotransferase
Query= SwissProt::P58350 (410 letters) >FitnessBrowser__azobra:AZOBR_RS12970 Length = 401 Score = 504 bits (1298), Expect = e-147 Identities = 245/395 (62%), Positives = 300/395 (75%) Query: 15 ASRISSIGVSEILKIGARAAAMKREGKPVIILGAGEPDFDTPEHVKQAASDAIHRGETKY 74 ASR+S I S + + +A + G+ VI LGAGEPDFDTP+++K AA AI G+TKY Sbjct: 5 ASRLSRIKPSPTIAVTQKARELAAAGRDVIGLGAGEPDFDTPDNIKDAAIKAIQAGDTKY 64 Query: 75 TALDGTPELKKAIREKFQRENGLAYELDEITVATGAKQILFNAMMASLDPGDEVIIPTPY 134 TA+DGTP LKKAI KF+RENGL Y D+ITV G KQ+L+NA+MA+L PGDEVIIP PY Sbjct: 65 TAVDGTPALKKAICAKFERENGLKYAPDQITVGVGGKQVLYNALMATLTPGDEVIIPAPY 124 Query: 135 WTSYSDIVHICEGKPVLIACDASSGFRLTAEKLEAAITPRTRWVLLNSPSNPSGAAYSAA 194 W SY D+V + EG PV ++C A GF+L LE AITP+T+W++LNSPSNPSGAAY+ Sbjct: 125 WVSYPDMVELAEGTPVFVSCPAEQGFKLQPADLEKAITPKTKWLILNSPSNPSGAAYTRD 184 Query: 195 DYRPLLEVLLRHPHVWLLVDDMYEHIVYDGFRFVTPAQLEPGLKNRTLTVNGVSKAYAMT 254 + + L +VL++HP VW++ DDMYEH++YDG FVTPAQ+EP L +RTLTVNGVSK+YAMT Sbjct: 185 EMKALTDVLVKHPQVWVMTDDMYEHLLYDGIEFVTPAQVEPALYDRTLTVNGVSKSYAMT 244 Query: 255 GWRIGYAGGPRELIKAMAVVQSQATSCPSSISQAASVAALNGPQDFLKERTESFQRRRDL 314 GWRIGYAGGP+ LIKAM V+QSQ+TS P+SI+QAA+V ALNGPQDF+ ER F +RRDL Sbjct: 245 GWRIGYAGGPKALIKAMGVIQSQSTSNPTSIAQAAAVEALNGPQDFIAERAAVFAQRRDL 304 Query: 315 VVNGLNAIDGLDCRVPEGAFYTFSGCAGVLGKVTPSGKRIKTDTDFCAYLLEDAHVAVVP 374 VV+ LN G+ C PEGAFY + CAG +GK TP GK I+TD DF YLLE VAVV Sbjct: 305 VVSMLNQAKGISCPKPEGAFYVYPSCAGTIGKTTPDGKVIETDEDFVTYLLESEGVAVVQ 364 Query: 375 GSAFGLSPFFRISYATSEAELKEALERIAAACDRL 409 GSAFGL+P FRISYATS L+EA +RI AC L Sbjct: 365 GSAFGLAPHFRISYATSTEALEEACKRIQRACGNL 399 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 552 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 401 Length adjustment: 31 Effective length of query: 379 Effective length of database: 370 Effective search space: 140230 Effective search space used: 140230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory