GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asd in Azospirillum brasilense Sp245

Align Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 (characterized)
to candidate AZOBR_RS13975 AZOBR_RS13975 aspartate-semialdehyde dehydrogenase

Query= SwissProt::P23247
         (337 letters)



>FitnessBrowser__azobra:AZOBR_RS13975
          Length = 339

 Score =  280 bits (716), Expect = 4e-80
 Identities = 149/336 (44%), Positives = 216/336 (64%), Gaps = 6/336 (1%)

Query: 5   FNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTV-RVQNVEEFD 63
           + VA+ GATG VG  ML  L +R FP D +  LA++ + GK   F    V +V++V  FD
Sbjct: 3   YTVAVVGATGNVGREMLTTLADRRFPADAVIALAADSAVGKEVSFGEDAVLKVEDVGRFD 62

Query: 64  WSQVHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAEFRN 123
           +  V IALF+A  ++SA  AP  A AG VVID +  FR D D+PLV+PEVN +A+A +  
Sbjct: 63  FKGVDIALFAADAKVSAAHAPRGAAAGAVVIDASPQFRMDPDVPLVIPEVNGDALAGYAK 122

Query: 124 RNIIANPNCSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNGY 183
           +NI+A+P  + I + +ALKP+++ V + R+ V+TYQ+ S AGK G+DEL GQT  +    
Sbjct: 123 KNIVASPGGAAILLAMALKPLHEQVTVSRVVVSTYQAASDAGKEGMDELFGQTRAIYVND 182

Query: 184 PAETNTFSQQIAFNCIPQIDQFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFY 243
           P + + FS+QIAFN IP I  FM++G T++E  +  ET+K+  DP I V+ TCVRVPVF 
Sbjct: 183 PVQKSVFSKQIAFNVIPHIGPFMEDGATRDEWALTVETKKVL-DPKIKVSATCVRVPVFI 241

Query: 244 GHAEAVHVETRAPIDAEQVMDMLEQTDGIELF---RGADFPTQVRDAGGKDHVLVGRVRN 300
           GH+ A+ +E   P+ AE+   +L +  G+++        + T V +  G D V + R+R 
Sbjct: 242 GHSAAITIECVEPVTAEEARRILRKAPGMQVIDQQENDGYITPV-EIAGDDPVFISRIRE 300

Query: 301 DISHHSGINLWVVADNVRKGAATNAVQIAELLVRDY 336
           D +  +G++ W   DN+RKGAA NAVQIAELLV++Y
Sbjct: 301 DYTVDNGLSFWASTDNLRKGAALNAVQIAELLVKEY 336


Lambda     K      H
   0.319    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 306
Number of extensions: 17
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 337
Length of database: 339
Length adjustment: 28
Effective length of query: 309
Effective length of database: 311
Effective search space:    96099
Effective search space used:    96099
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate AZOBR_RS13975 AZOBR_RS13975 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))

Software error:

../bin/blast/fastacmd -i /tmp/list.18395.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.18395.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.