Align Homoserine O-succinyltransferase; HST; EC 2.3.1.46; Homoserine transsuccinylase; HTS (uncharacterized)
to candidate AZOBR_RS20475 AZOBR_RS20475 homoserine acetyltransferase
Query= curated2:A0LCI7 (394 letters) >FitnessBrowser__azobra:AZOBR_RS20475 Length = 394 Score = 385 bits (990), Expect = e-112 Identities = 199/374 (53%), Positives = 249/374 (66%), Gaps = 13/374 (3%) Query: 15 PQHVRLFGASTPLQLDGGTLLHSVDVSYETYGTLNQERSNAVLICHALSGNAHAAGYHSK 74 P H G P++LD G L +V+Y+TYG LN +RSNA+LICHAL+G+ + H Sbjct: 13 PGHRVTLGVDRPMRLDSGAELGPFEVAYQTYGALNADRSNAILICHALTGDHYVLDQHPV 72 Query: 75 DDKRPGWWDHYIGPGKPFDTNRYFVIASNNLGGCDGTTGPSSIDPATGMPYGLNFPMITI 134 K PGWW+ +GPGKP DT+RYFVI SN +GGC G+TGP DPATG PYGL FP+ITI Sbjct: 73 TGK-PGWWEMLVGPGKPVDTDRYFVICSNVIGGCMGSTGPKETDPATGEPYGLGFPVITI 131 Query: 135 GDIVRVQHALVRQLGIERLMAVVGGSMGGMQALQWALDYPHMVPASVIIAAAPRLTAQNI 194 GD+VR Q LV LGI++L V+GGSMGGMQ LQWA+ YP V A+V IA A R +AQNI Sbjct: 132 GDMVRAQKLLVEHLGIDQLFCVIGGSMGGMQVLQWAVAYPESVFAAVPIATAARHSAQNI 191 Query: 195 AFNAVARQAIMADPHFNGGDYYTLPGDPTTKARPESGLALARMMAHITYLSEQGLHERFG 254 AF+ V RQAIMADP + GG+ Y L G RP GLA+ARM AHITYLSE LH +FG Sbjct: 192 AFHEVGRQAIMADPDWAGGN-YLLEG-----TRPHRGLAVARMAAHITYLSEPALHRKFG 245 Query: 255 RRLQDRDALSYGFETDFAVESYLSYQGSSFVKRFDANSYLYITKAMDYFDPFPD------ 308 R LQ+R ++YGF+ DF VESYL +QG +FV+RFDANSYLYIT+AMDYFD D Sbjct: 246 RNLQNRQTVTYGFDADFQVESYLRHQGITFVERFDANSYLYITRAMDYFDLAADYGGGTL 305 Query: 309 AETTVQRLTGVESHFLVMSFDTDWRFDTSRSKELVRILHRSLKDCTFQEFSSPAGHDAFL 368 + + G F + SF +DW F TS S+ +V L+ + +F E + GHD+FL Sbjct: 306 SNAFRKDGKGTPVRFCLASFSSDWLFPTSESRAIVHALNAVAANVSFVEIRTDKGHDSFL 365 Query: 369 LPHPSYEKSLGSFL 382 L P + + + FL Sbjct: 366 LDEPEFHQVIRGFL 379 Lambda K H 0.320 0.136 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 569 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 394 Length adjustment: 31 Effective length of query: 363 Effective length of database: 363 Effective search space: 131769 Effective search space used: 131769 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory