Align Cystathionine gamma-synthase; CGS; EC 2.5.1.48; O-succinylhomoserine (thiol)-lyase (uncharacterized)
to candidate AZOBR_RS08650 AZOBR_RS08650 cystathionine beta-lyase
Query= curated2:Q1M0P5 (380 letters) >FitnessBrowser__azobra:AZOBR_RS08650 Length = 392 Score = 223 bits (568), Expect = 7e-63 Identities = 138/388 (35%), Positives = 207/388 (53%), Gaps = 20/388 (5%) Query: 5 TKLIHGGISEDATTGAVSVPIYQTSTYRQDAI-----GHHKGYE---YSRSGNPTRFALE 56 T L H G S G V+ P+Y ST + G H ++ Y R G PT A E Sbjct: 8 TVLGHAGRSPRENHGIVNPPVYHCSTVLFPTLEDLEAGDHAPFDRINYGRIGTPTTLAFE 67 Query: 57 ELIADLEGGVKGFAFASGLAGIH-AVFSLLQSGDHVLLGDDVYGGTFRLFNKVLVKNGLS 115 + I +LEG + SGL I A+F+ ++GDHVL+ D YG T R N LV G+ Sbjct: 68 QAITELEGAYRSVNTGSGLNAIATALFAFTKTGDHVLITDSAYGPTRRFANDTLVPYGVE 127 Query: 116 CTIIDTSDLSQIKKAIKPNTKALYLETPSNPLLKITDLAQCASVAKDHGLLTIVDNTFAT 175 D + + I + +KPNT ++LE+P + ++ D+ A+ AK G ++DNT+AT Sbjct: 128 VEYFDPTIGAGITRLLKPNTSVVFLESPGSLTFEVQDVPAIAAAAKTVGATVMIDNTWAT 187 Query: 176 PYYQNPLLLGADIVVHSGTKYLGGHSDVVAGLVTTNNEALAQEIAFFQNAIGGVLGPQDS 235 P + PL G D+ +HS TKY+ GH+D + G+++ NEA + G GP D Sbjct: 188 PLFFQPLRHGVDVSIHSATKYIVGHADAMLGVISCANEAQWLAVKKAATRTGTCAGPDDI 247 Query: 236 WLLQRGIKTLGLRMQAHQKNALCVAEFLEKHPKVERVYYPGLPTHPNYELAKKQMRGFSG 295 +L RG++TL +R++ H+ +AL +AE+L K P+V R+ +P P P +EL K+ + SG Sbjct: 248 YLGLRGLRTLSVRLKQHEASALALAEWLSKQPEVTRILHPAFPDCPGHELWKRDIGRSSG 307 Query: 296 MLSFTLKN--DSEATPFVESLKLFILGESLGGVESLVGVPAFMTHACIPKTQREAAGIRD 353 + S + + + SL+LF LG S GG ESL+ +PA P R A D Sbjct: 308 LFSIVMNTVPKPALSAMLNSLELFGLGYSWGGFESLI-LPA------RPAAIRTATRWTD 360 Query: 354 --GLVRLSVGIEHEQDLLEDLEQAFAKI 379 ++RL G+E DL+ DL+ AFA++ Sbjct: 361 PGTMLRLHAGLEDVDDLIRDLDGAFARL 388 Lambda K H 0.318 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 392 Length adjustment: 30 Effective length of query: 350 Effective length of database: 362 Effective search space: 126700 Effective search space used: 126700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory