Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate AZOBR_RS20475 AZOBR_RS20475 homoserine acetyltransferase
Query= SwissProt::Q9AAS1 (382 letters) >FitnessBrowser__azobra:AZOBR_RS20475 Length = 394 Score = 514 bits (1325), Expect = e-150 Identities = 250/367 (68%), Positives = 291/367 (79%), Gaps = 5/367 (1%) Query: 20 NEPLRLDSGGVIEGLEIAYQTYGQLNADKSNAVLICHALTGDQHVASPHPTTGKPGWWQR 79 + P+RLDSG + E+AYQTYG LNAD+SNA+LICHALTGD +V HP TGKPGWW+ Sbjct: 22 DRPMRLDSGAELGPFEVAYQTYGALNADRSNAILICHALTGDHYVLDQHPVTGKPGWWEM 81 Query: 80 LVGPGKPLDPARHFIICSNVIGGCMGSTGPASINPATGKTYGLSFPVITIADMVRAQAML 139 LVGPGKP+D R+F+ICSNVIGGCMGSTGP +PATG+ YGL FPVITI DMVRAQ +L Sbjct: 82 LVGPGKPVDTDRYFVICSNVIGGCMGSTGPKETDPATGEPYGLGFPVITIGDMVRAQKLL 141 Query: 140 VSALGVETLFAVVGGSMGGMQVQQWAVDYPERMFSAVVLASASRHSAQNIAFHEVGRQAI 199 V LG++ LF V+GGSMGGMQV QWAV YPE +F+AV +A+A+RHSAQNIAFHEVGRQAI Sbjct: 142 VEHLGIDQLFCVIGGSMGGMQVLQWAVAYPESVFAAVPIATAARHSAQNIAFHEVGRQAI 201 Query: 200 MADPDWRGGAYAEHGVRPEKGLAVARMAAHITYLSEPALQRKFGRELQ-RDGLSWGFDAD 258 MADPDW GG Y G RP +GLAVARMAAHITYLSEPAL RKFGR LQ R +++GFDAD Sbjct: 202 MADPDWAGGNYLLEGTRPHRGLAVARMAAHITYLSEPALHRKFGRNLQNRQTVTYGFDAD 261 Query: 259 FQVESYLRHQGSSFVDRFDANSYLYITRAMDYFDIAASH-GGVLAKAFT---RARNVRFC 314 FQVESYLRHQG +FV+RFDANSYLYITRAMDYFD+AA + GG L+ AF + VRFC Sbjct: 262 FQVESYLRHQGITFVERFDANSYLYITRAMDYFDLAADYGGGTLSNAFRKDGKGTPVRFC 321 Query: 315 VLSFSSDWLYPTAENRHLVRALTAAGARAAFAEIESDKGHDAFLLDEPVMDAALEGFLAS 374 + SFSSDWL+PT+E+R +V AL A A +F EI +DKGHD+FLLDEP + GFL Sbjct: 322 LASFSSDWLFPTSESRAIVHALNAVAANVSFVEIRTDKGHDSFLLDEPEFHQVIRGFLDG 381 Query: 375 AERDRGL 381 RGL Sbjct: 382 CAEHRGL 388 Lambda K H 0.321 0.135 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 585 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 394 Length adjustment: 30 Effective length of query: 352 Effective length of database: 364 Effective search space: 128128 Effective search space used: 128128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate AZOBR_RS20475 AZOBR_RS20475 (homoserine acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.23033.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-145 470.0 0.0 2.6e-145 469.8 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS20475 AZOBR_RS20475 homoserine acetylt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS20475 AZOBR_RS20475 homoserine acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 469.8 0.0 2.6e-145 2.6e-145 3 350 .. 23 379 .. 21 380 .. 0.97 Alignments for each domain: == domain 1 score: 469.8 bits; conditional E-value: 2.6e-145 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk.GWWdellGpgraldt 70 +++ l+sG++l +evay+tyG lna+r+Na+l+cHaltg++ v +++ + k GWW+ l+Gpg+++dt lcl|FitnessBrowser__azobra:AZOBR_RS20475 23 RPMRLDSGAELGPFEVAYQTYGALNADRSNAILICHALTGDHYVLDQHPVTGKpGWWEMLVGPGKPVDT 91 5789*****************************************999877667*************** PP TIGR01392 71 sryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGG 139 +ryfv+c+Nv+G+c GstgP ++p+tg+pyg fP++ti D+v+aqk l+++Lg+++l++v+GgS+GG lcl|FitnessBrowser__azobra:AZOBR_RS20475 92 DRYFVICSNVIGGCMGSTGPKETDPATGEPYGLGFPVITIGDMVRAQKLLVEHLGIDQLFCVIGGSMGG 160 ********************************************************************* PP TIGR01392 140 mqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARml 207 mq+l+wa++ype+v ++v++at+ar+saq+iaf+ev rqai++Dp++ +G+y e+ +P++GLa+ARm lcl|FitnessBrowser__azobra:AZOBR_RS20475 161 MQVLQWAVAYPESVFAAVPIATAARHSAQNIAFHEVGRQAIMADPDWAGGNYLLEGtRPHRGLAVARMA 229 *****************************************************9999************ PP TIGR01392 208 alltYrseesleerfgreakseeslassleeefsvesylryqgkkfverFdAnsYllltkaldthdlar 276 a++tY+se +l+++fgr+ ++++++++ ++++f+vesylr+qg +fverFdAnsYl++t+a+d++dla+ lcl|FitnessBrowser__azobra:AZOBR_RS20475 230 AHITYLSEPALHRKFGRNLQNRQTVTYGFDADFQVESYLRHQGITFVERFDANSYLYITRAMDYFDLAA 298 ********************************************************************* PP TIGR01392 277 gr.rdslkealkk....ikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFlle 338 ++ + l++a++k + +++++++++sD+lf+++e++ +++al+a++++ ++ei++++GHD+Fll+ lcl|FitnessBrowser__azobra:AZOBR_RS20475 299 DYgGGTLSNAFRKdgkgTPVRFCLASFSSDWLFPTSESRAIVHALNAVAANvsFVEIRTDKGHDSFLLD 367 *96678999*97644447899*************************9998888**************** PP TIGR01392 339 kekveelirefl 350 + +++++ir fl lcl|FitnessBrowser__azobra:AZOBR_RS20475 368 EPEFHQVIRGFL 379 *********997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (394 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.83 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory