Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate AZOBR_RS02140 AZOBR_RS02140 O-succinylhomoserine sulfhydrylase
Query= SwissProt::P9WGB5 (406 letters) >FitnessBrowser__azobra:AZOBR_RS02140 Length = 402 Score = 417 bits (1073), Expect = e-121 Identities = 214/384 (55%), Positives = 276/384 (71%), Gaps = 5/384 (1%) Query: 24 VRGGMLRSGFEETAEAMYLTSGYVYGSAAVAEKSFAGELDHYVYSRYGNPTVSVFEERLR 83 V GG+ RS F+ET EA+Y TSG+VYGSA AE +F + +VYSR+ NPT ++FE+RL Sbjct: 21 VHGGVRRSSFDETCEALYQTSGFVYGSAEEAESAFVNDGSRHVYSRFRNPTTAMFEDRLC 80 Query: 84 LIEGAPAAFATASGMAAVFTSLGALLGAGDRLVAARSLFGSCFVVCSEILPRWGVQTVFV 143 EGA A+AT SGMAAV +L + L GDR+VA RSLF SC+ V E+ R+GV+ VFV Sbjct: 81 EYEGAAWAYATTSGMAAVHGALWSNLRTGDRIVAPRSLFISCYWVIKELSARFGVEAVFV 140 Query: 144 DGDDLSQWERALSVPTQAVFFETPSNPMQSLVDIAAVTELAHAAGAKVVLDNVFATPLLQ 203 DG DLSQWE AL+ PT+ VF ETPSNP +VD+ AV+ LAH AGAKVV+DN FATP+LQ Sbjct: 141 DGTDLSQWEEALAKPTKVVFLETPSNPGLEVVDLRAVSALAHKAGAKVVVDNAFATPVLQ 200 Query: 204 QGFPLGVDVVVYSGTKHIDGQGRVLGGAIL-GDREYIDGPVQKLMRHTGPAMSAFNAWVL 262 + F +G DVV+YS TKHIDGQGR LGG IL D++Y + +RHTGP +S FNAW+L Sbjct: 201 RPFEMGADVVIYSATKHIDGQGRCLGGIILTNDKQYGSDVIHPYLRHTGPTISPFNAWLL 260 Query: 263 LKGLETLAIRVQHSNASAQRIAEFLNGHPSVRWVRYPYLPSHPQYDLAKRQMSGGGTVVT 322 LKGLETL +RV +A+A +AEFL GH V V YP L SHPQ+DL + QM+GGGT+++ Sbjct: 261 LKGLETLELRVSAQSAAALTVAEFLEGHAKVERVLYPGLASHPQHDLVRSQMTGGGTMLS 320 Query: 323 FALDCPEDVAKQRAFEVLDKMRLIDISNNLGDAKSLVTHPATTTHRAMGPEGRAAIGLGD 382 L K+ AF L+ +R++ ISNNLGD+KSL+THP TTTH + E +AA + Sbjct: 321 IFL----KGGKEEAFRALNDLRMVMISNNLGDSKSLITHPDTTTHSKLTVEEKAAANIRP 376 Query: 383 GVVRISVGLEDTDDLIADIDRALS 406 ++R+SVGLED D++ D+DRAL+ Sbjct: 377 NLLRLSVGLEDAQDIVEDLDRALA 400 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 476 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 402 Length adjustment: 31 Effective length of query: 375 Effective length of database: 371 Effective search space: 139125 Effective search space used: 139125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory