GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argB in Azospirillum brasilense Sp245

Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate AZOBR_RS03285 AZOBR_RS03285 acetylglutamate kinase

Query= BRENDA::Q9HTN2
         (301 letters)



>FitnessBrowser__azobra:AZOBR_RS03285
          Length = 299

 Score =  325 bits (834), Expect = 6e-94
 Identities = 163/292 (55%), Positives = 215/292 (73%)

Query: 4   SRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPV 63
           +RD+    A+ LSEALPY+RR+ G+T VIKYGG+AM  + L   FARD+VL+K VGINPV
Sbjct: 5   TRDEWLAKARTLSEALPYMRRYAGRTFVIKYGGHAMGDDSLAEKFARDIVLLKQVGINPV 64

Query: 64  VVHGGGPQIGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSA 123
           VVHGGGPQIG +L+RL+I+S FIDG+RVTD  T++VVEMVL G +NK IV  IN  GG A
Sbjct: 65  VVHGGGPQIGQMLQRLAIKSSFIDGLRVTDKETVEVVEMVLAGSINKQIVAAINNAGGRA 124

Query: 124 IGLTGKDAELIRAKKLTVTRQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIA 183
           +GL+GKD  LI A+KL  T++ P+    +++D+G VGE   VN  ++  L + D IPVIA
Sbjct: 125 VGLSGKDGSLITARKLRRTQRDPDSNIEKVLDLGFVGEPYQVNPQIITSLAQSDIIPVIA 184

Query: 184 PIGVGSNGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELI 243
           PIG   NG++YNINAD  AG VA AL A +  LLT++AG++DK  +++  +S +Q    I
Sbjct: 185 PIGFDRNGDTYNINADTAAGAVASALGATRFFLLTDVAGVLDKNKELVPRMSLDQARAAI 244

Query: 244 ADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLI 295
           ADGT  GGM+PKI   ++AV+ GV +A I+DGRVP+A+LLEIFT+ G GTLI
Sbjct: 245 ADGTATGGMIPKIETCIDAVEQGVDAAVILDGRVPHALLLEIFTEGGAGTLI 296


Lambda     K      H
   0.318    0.138    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 281
Number of extensions: 10
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 301
Length of database: 299
Length adjustment: 27
Effective length of query: 274
Effective length of database: 272
Effective search space:    74528
Effective search space used:    74528
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

Align candidate AZOBR_RS03285 AZOBR_RS03285 (acetylglutamate kinase)
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))

Software error:

../bin/blast/fastacmd -i /tmp/list.24508.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.24508.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.