GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argC in Azospirillum brasilense Sp245

Align Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic; AGPR; N-acetyl-glutamate semialdehyde dehydrogenase; NAGSA dehydrogenase; EC 1.2.1.38 (characterized)
to candidate AZOBR_RS07795 AZOBR_RS07795 N-acetyl-gamma-glutamyl-phosphate reductase

Query= SwissProt::Q93Z70
         (401 letters)



>FitnessBrowser__azobra:AZOBR_RS07795
          Length = 350

 Score =  415 bits (1066), Expect = e-120
 Identities = 206/343 (60%), Positives = 252/343 (73%)

Query: 59  IRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVK 118
           IR+G+LGASGYTGAE+VR+L  HP  ++  +TA+R+AG+ M  VFPHL    LP LV ++
Sbjct: 8   IRVGILGASGYTGAELVRMLLRHPGVEICALTAERQAGKPMAEVFPHLGQFNLPGLVKIE 67

Query: 119 DADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVEL 178
           +  +  +DAVFC LPHGTTQE+I  LP  +K+VDLSADFRL + AEY  WYG  H+AVEL
Sbjct: 68  EVAWDKLDAVFCALPHGTTQEVIAGLPRHIKVVDLSADFRLSDPAEYATWYGHEHRAVEL 127

Query: 179 QKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSG 238
           QKEV YGLTE  R+ ++KAR+VANPGCYPT   L L+PLL   +I+   I+IDAKSGVSG
Sbjct: 128 QKEVAYGLTEFNRQGVRKARVVANPGCYPTCSLLALLPLLMDEMIEPGGIVIDAKSGVSG 187

Query: 239 AGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQ 298
           AGR AK+ NL++E++EG ++YGV  HRH+PEIEQ L   A   VTVSFTPHL+PM RGM 
Sbjct: 188 AGRDAKQQNLFTEVSEGFNAYGVGHHRHMPEIEQELRLAAGRPVTVSFTPHLVPMNRGMM 247

Query: 299 STIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIP 358
           +TIYV MA GV  +DL   L   YE E FV V   G+ P T +VR SN   + VFPDR P
Sbjct: 248 ATIYVRMADGVTADDLRATLTARYESEPFVNVTAAGIAPATRHVRASNQALIGVFPDRTP 307

Query: 359 GRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 401
             AII+SVIDNLVKGASGQA+QN+N+M G  ETTGL   PLFP
Sbjct: 308 RGAIIVSVIDNLVKGASGQAIQNMNVMFGLGETTGLEQAPLFP 350


Lambda     K      H
   0.318    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 437
Number of extensions: 11
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 401
Length of database: 350
Length adjustment: 30
Effective length of query: 371
Effective length of database: 320
Effective search space:   118720
Effective search space used:   118720
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate AZOBR_RS07795 AZOBR_RS07795 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))

Software error:

../bin/blast/fastacmd -i /tmp/list.20021.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.20021.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.