Align δ1-pyrroline-5-carboxylate synthetase (EC 1.2.1.41; EC 2.7.2.11) (characterized)
to candidate AZOBR_RS04075 AZOBR_RS04075 gamma-glutamyl phosphate reductase
Query= metacyc::AT2G39800-MONOMER (717 letters) >FitnessBrowser__azobra:AZOBR_RS04075 Length = 426 Score = 273 bits (699), Expect = 1e-77 Identities = 155/408 (37%), Positives = 238/408 (58%), Gaps = 15/408 (3%) Query: 301 AARESSRKLQALSSEDRKKILLDIADALEANVTTIKAENELDVASAQEAGLEESMVARLV 360 AAR ++ +L + S + + L A A+ A I+A N+ DVA+A++ GL M+ RL Sbjct: 21 AARAAAAELATVPSPSKDQALRAAAAAIRARKAEIQAANDADVAAAKDRGLAGPMIERLA 80 Query: 361 MTPGKISSLAASVRKLADMEDPIGRVLKKTEVADGLVLEKTSSPLGVLLIVFESRPDALV 420 + +I ++A + +AD DPIG V+ + +GL +++ PLGV+ I++ESRP+ Sbjct: 81 LNDARIEAMAKGLEDIADFPDPIGGVIAEWTRPNGLAIQRVRVPLGVIGIIYESRPNVTA 140 Query: 421 QIASLAIRSGNGLLLKGGKEARRSNAILHKVITDAI-----PETVGGKLIGLV--TSREE 473 L ++SGN +L+GG E+ RS+ + + D + PE I LV T R Sbjct: 141 DAGGLCLKSGNAAILRGGSESIRSSHAIAACLADGLRAAGLPEAA----IQLVPTTDRAA 196 Query: 474 IPDLLKLDDVIDLVIPRGSNKLVTQIKNTTKIPVLGHADGICHVYVDKACDTDMAKRIVS 533 + +L + D ID+++PRG L+ +I ++IPV+ H DG VYVD D + A+++V Sbjct: 197 VGHMLTMRDFIDVIVPRGGKSLIQRIAEESRIPVIKHLDGNNTVYVDAGADPEKARKVVM 256 Query: 534 DAKLDYPAACNAMETLLVHKDLEQNAVLNELIFALQSNGVTLYGGPRASKI---LNIPEA 590 +AK+ + C A ETLLV + + +A+L L+ L G + G A + + A Sbjct: 257 NAKMRRTSICGAAETLLVDRKIA-DAMLPVLVKDLLDAGCAVRGDAAAQAVDPRVTAVTA 315 Query: 591 RSFNHEYCAKACTVEVVEDVYGAIDHIHRHGSAHTDCIVTEDHEVAELFLRQVDSAAVFH 650 ++ E+ VV+ V GAIDHI+RHGS HTD IVTED AE FL+++DS V Sbjct: 316 EDWDTEFLDAIIACGVVDGVDGAIDHINRHGSHHTDAIVTEDPAAAERFLQRIDSGIVLW 375 Query: 651 NASTRFSDGFRFGLGAEVGVSTGRIHARGPVGVEGLLTTRWIMRGKGQ 698 NAST+F+DG FG+GAE+G+ST + HARGPVG E L + ++++RG GQ Sbjct: 376 NASTQFADGGEFGMGAEIGISTDKFHARGPVGAEQLTSYKYVVRGDGQ 423 Lambda K H 0.318 0.135 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 621 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 717 Length of database: 426 Length adjustment: 36 Effective length of query: 681 Effective length of database: 390 Effective search space: 265590 Effective search space used: 265590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory