Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate AZOBR_RS04095 AZOBR_RS04095 glutamate 5-kinase
Query= reanno::Korea:Ga0059261_3512 (367 letters) >FitnessBrowser__azobra:AZOBR_RS04095 Length = 376 Score = 332 bits (850), Expect = 1e-95 Identities = 196/369 (53%), Positives = 247/369 (66%), Gaps = 16/369 (4%) Query: 11 RLVVKIGSALLVDPE-GAIRRDWLEGIAADIAARVRAGQQIAVVSSGAIALGARRLKLAK 69 RLVVKIGSALLVD G +RR+WL+ +A D+AA + GQ++ +V+SGA+A G L L Sbjct: 10 RLVVKIGSALLVDSATGRMRREWLDALADDVAACRKRGQEVVIVTSGAVACGREHLGLV- 68 Query: 70 GGRA-SLEDAQAAAATGQIALSQVWAEVLAANGLTAAQMLVTLDDLEDRRRYLNAAATLG 128 GRA LE+ QAAAATGQI L+ + E LA +GLT AQ+LVTL+D E+RRR+LN AT+ Sbjct: 69 -GRALRLEEKQAAAATGQIRLAAAYQETLARHGLTVAQVLVTLEDTEERRRHLNGRATID 127 Query: 129 RLLSLGVVPVINENDSVATAEIRFGDNDRLAARVAQAADASGVVLLSDIDGLYDRNPAL- 187 LL LG VPVINEND+VATAEIRFGDNDRLAARVAQ A +VLLSDIDGLY +P Sbjct: 128 TLLKLGAVPVINENDTVATAEIRFGDNDRLAARVAQMISADTLVLLSDIDGLYTADPRKD 187 Query: 188 PGAVHIPVVERIDGRVEGMADRGSASGMGSGGMVSKIEAARIAASAGVSLAIANGRVDRP 247 P A HIPVV+ + +E MA G SGGMV+KI AAR+A +AG + IA G+ P Sbjct: 188 PDARHIPVVQELTSDIENMAGE-PPPGYSSGGMVTKIVAARVALAAGCRMVIAKGKRMNP 246 Query: 248 LSA--------DARHTVFLP-EKRTRARKAWLAGRLTAKGSIIVDAGAAQALTEGRSLLA 298 L+A A T FLP + ARKAW+ G L A G++ VDAGA AL G SLL Sbjct: 247 LAALEQRPEQGGALCTWFLPAASPSSARKAWIGGNLNAHGALTVDAGALSALARGASLLP 306 Query: 299 IGATAIRGMFFRGDLVTIEGPNG-PIARGLSEYDAPDAQAILGTRSDDQGEILGYAPRST 357 G A+ G F RGD+V ++ P+G +ARGL+ Y A DA+ I G +S + EILGY R Sbjct: 307 AGVRAVEGDFERGDVVVVKAPDGREVARGLTAYAAEDARRIAGRKSHEIEEILGYRGRDE 366 Query: 358 LVHRNHMAL 366 ++HR+ + + Sbjct: 367 MIHRDDLVV 375 Lambda K H 0.319 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 376 Length adjustment: 30 Effective length of query: 337 Effective length of database: 346 Effective search space: 116602 Effective search space used: 116602 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate AZOBR_RS04095 AZOBR_RS04095 (glutamate 5-kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.12327.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-126 406.5 0.0 6.1e-126 406.4 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS04095 AZOBR_RS04095 glutamate 5-kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS04095 AZOBR_RS04095 glutamate 5-kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 406.4 0.0 6.1e-126 6.1e-126 1 362 [. 9 374 .. 9 375 .. 0.97 Alignments for each domain: == domain 1 score: 406.4 bits; conditional E-value: 6.1e-126 TIGR01027 1 kriVvKlGsssLteesgk.lkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkklaek 68 +r+VvK+Gs++L+++ + ++r+ l +l+ +va+ +k G+evviv+SGava G e+Lgl r +l+ek lcl|FitnessBrowser__azobra:AZOBR_RS04095 9 RRLVVKIGSALLVDSATGrMRREWLDALADDVAACRKRGQEVVIVTSGAVACGREHLGLVGRALRLEEK 77 589***********99887************************************************** PP TIGR01027 69 QalaaVGQgrLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDtvav 137 Qa+aa GQ rL ++y+++++++gl+vaQ+L t +d ++r+r+lN r+t+++ll+lg+vp++NENDtva+ lcl|FitnessBrowser__azobra:AZOBR_RS04095 78 QAAAATGQIRLAAAYQETLARHGLTVAQVLVTLEDTEERRRHLNGRATIDTLLKLGAVPVINENDTVAT 146 ********************************************************************* PP TIGR01027 138 eeikfGDNDtLsalvaalveAdlLvlltdvdgLydadprtnpdAklieeveeieeelkavagssgssvG 206 +ei+fGDND+L+a va++++Ad+Lvll+d+dgLy+adpr++pdA+ i++v+e++++++++ag+ + + lcl|FitnessBrowser__azobra:AZOBR_RS04095 147 AEIRFGDNDRLAARVAQMISADTLVLLSDIDGLYTADPRKDPDARHIPVVQELTSDIENMAGEPPPGYS 215 ****************************************************************999** PP TIGR01027 207 TGGmrtKleaaelAsragveviiasgekpekiadlle....daavgtlfeakkkklknrkqwilaasea 271 GGm tK+ aa++A +ag +++ia+g++ + +a+l + + a+ t f + ++ ++rk+wi +++a lcl|FitnessBrowser__azobra:AZOBR_RS04095 216 SGGMVTKIVAARVALAAGCRMVIAKGKRMNPLAALEQrpeqGGALCTWFLPAASPSSARKAWIGGNLNA 284 *****************************999998874444566779********************** PP TIGR01027 272 kGkiivdegaeeallekgksLlpagvvevegnFsrgevveilaeegqeigkglvnysseelekikglks 340 +G+++vd+ga +al + g+sLlpagv +veg+F+rg+vv ++a++g+e+++gl++y +e+ ++i+g+ks lcl|FitnessBrowser__azobra:AZOBR_RS04095 285 HGALTVDAGALSALAR-GASLLPAGVRAVEGDFERGDVVVVKAPDGREVARGLTAYAAEDARRIAGRKS 352 **************98.**************************************************** PP TIGR01027 341 eeiedvLgyekkeevvhrdnlv 362 +eie++Lgy+ ++e +hrd+lv lcl|FitnessBrowser__azobra:AZOBR_RS04095 353 HEIEEILGYRGRDEMIHRDDLV 374 ********************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (376 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.69 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory