Align Threonine synthase; TS; EC 4.2.3.1 (uncharacterized)
to candidate AZOBR_RS16025 AZOBR_RS16025 threonine synthase
Query= curated2:Q58860 (405 letters) >FitnessBrowser__azobra:AZOBR_RS16025 Length = 413 Score = 227 bits (579), Expect = 4e-64 Identities = 135/376 (35%), Positives = 199/376 (52%), Gaps = 3/376 (0%) Query: 5 CIKCGKTYDVDEIIYTCECGGLLEIIYDYEEIKDKVSEEKLRKREIGVWRYLEYLPVKDE 64 C G+ Y+ D + + G L + YD E ++ ++++ L +R +WRY E LPV+ Sbjct: 20 CAYTGERYEADTVHNLSKAGKPLLVRYDLEGVRGALTKDALAERPQDLWRYRELLPVRRV 79 Query: 65 SKIVSLCEGGTPLYRCNNLEKELGIKELYVKNEGANPTGSFKDRGMTVGVTRANELGVEV 124 IVSL E TPL L +LG EL VK+EG PTGSFK RG+ + V+ A G++ Sbjct: 80 QDIVSLGEAVTPLVALPKLAAKLGAAELLVKDEGRLPTGSFKARGLVMAVSMAKAFGIKH 139 Query: 125 VGCASTGNTSASLAAYSARSGKKCIVLLPEGKVALGKLAQAMFYGAKVIQVKGNFDDALD 184 + + GN A+LAAY+ R+G K + PE + +++ GA V +V G DD Sbjct: 140 MAMPTNGNAGAALAAYATRAGIKTTIFCPEDTPEV-NVSEIELQGATVYRVNGLIDDCGK 198 Query: 185 MVKQ-LAKEKLIYLLNSINPFRLEGQKTIAFEICDQLNWQVPDRVIVPVGNAGNISAIWK 243 +V + AK + P+R+EG+KT+ E+ +QL W+VPD + P G + +WK Sbjct: 199 IVGEGKAKAGWFDVSTLKEPYRIEGKKTMGLELAEQLGWEVPDVIFYPTGGGTGLIGMWK 258 Query: 244 GFKEFEITGII-DELPKMTGIQADGAKPIVEAFRKRAKDIIPYKNPETIATAIRIGNPVN 302 F E E G I + P+M +QA G P+V A+ + + + TIA+ IR+ V Sbjct: 259 AFAELEAIGFIGSKRPRMVAVQAAGCAPMVRAYEAGEEHAPRWPDAHTIASGIRVPQAVG 318 Query: 303 APKALDAIYSSGGYAEAVTDEEIVEAQKLLARKEGIFVEPASASSIAGLKKLLEEGIIDR 362 L A+ SGG+A AV DE I A AR+EG + P A++ A K+ L +G + R Sbjct: 319 DFLILRAVRESGGFAVAVPDEAIQAALDEAAREEGFLLCPEGAATYAAYKQALGDGRVGR 378 Query: 363 DERIVCITTGHGLKDP 378 DER V GLK P Sbjct: 379 DERAVLFNCATGLKYP 394 Lambda K H 0.317 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 413 Length adjustment: 31 Effective length of query: 374 Effective length of database: 382 Effective search space: 142868 Effective search space used: 142868 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate AZOBR_RS16025 AZOBR_RS16025 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.1459.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-54 169.3 0.0 7.8e-54 169.0 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS16025 AZOBR_RS16025 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS16025 AZOBR_RS16025 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 169.0 0.0 7.8e-54 7.8e-54 2 329 .. 68 384 .. 67 394 .. 0.94 Alignments for each domain: == domain 1 score: 169.0 bits; conditional E-value: 7.8e-54 TIGR00260 2 vryreilevt.ekdlvdlaegstelfrspklaeevgaenlyvkelfhgPtlaFKDrglqfvavlltkal 69 +ryre+l+v +d+v+l e +t+l++ pkla+++ga +l vk+++ Pt++FK rg + ++++ a+ lcl|FitnessBrowser__azobra:AZOBR_RS16025 68 WRYRELLPVRrVQDIVSLGEAVTPLVALPKLAAKLGAAELLVKDEGRLPTGSFKARG---LVMAVSMAK 133 9*********99*********************************************...********* PP TIGR00260 70 elgnetvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDdaqd 138 g + ++ t G+ gaa+a a+a +a++k ++ P++ + + + ++a+v ++G Dd+ + lcl|FitnessBrowser__azobra:AZOBR_RS16025 134 AFGIKHMAMPTNGNAGAALA-AYATRAGIKTTIFCPED-TP--EVNVSEIELQGATVYRVNGLIDDCGK 198 ********************.*****************.56..6999********************** PP TIGR00260 139 lvkeifedkeklklnsvNsinparieaqktyafeiveqlgkespdkvvvpvp.sgnfgailkGflekke 206 +v e + ++ p+rie++kt+ e++eqlg+e pd + p + + + ++k+f e++ lcl|FitnessBrowser__azobra:AZOBR_RS16025 199 IVGEGKAKAGWFDVSTLK--EPYRIEGKKTMGLELAEQLGWEVPDVIFYPTGgGTGLIGMWKAFAELEA 265 ***988777788888887..9*******************************76678889********* PP TIGR00260 207 lg.....lpieklaiaaegaadivrrflksgdlepkedk.eTlstAmdignpsnveralelarrslgnl 269 g +p ++ a++a g+a++vr++ + + p+ +T++ +++ + + +l+++r+s+g + lcl|FitnessBrowser__azobra:AZOBR_RS16025 266 IGfigskRP-RMVAVQAAGCAPMVRAYEAGEEHAPRWPDaHTIASGIRVPQAVGDFLILRAVRESGGFA 333 ******999.*****************7777777665546**************99************* PP TIGR00260 270 edlkesvsdeeileaikklaeeegyllephtavavaalkklvekgvsatadpaKFeevve 329 ++ de+i a ++a+eeg ll p +a+++aa k+ + +g ++ ++ e++v+ lcl|FitnessBrowser__azobra:AZOBR_RS16025 334 VAV----PDEAIQAALDEAAREEGFLLCPEGAATYAAYKQALGDG---RVGRD--ERAVL 384 999....**********************************9999...88888..77776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (413 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.91 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory