Align anthranilate phosphoribosyltransferase (EC 2.4.2.18) (characterized)
to candidate AZOBR_RS07455 AZOBR_RS07455 anthranilate phosphoribosyltransferase
Query= BRENDA::A5U4M0 (370 letters) >FitnessBrowser__azobra:AZOBR_RS07455 Length = 357 Score = 250 bits (639), Expect = 4e-71 Identities = 149/350 (42%), Positives = 203/350 (58%), Gaps = 11/350 (3%) Query: 16 SPKAEAASVPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPT 75 +P A + IL ++ L +AA A D IM+GNA P+Q+ F +A+ ++ T Sbjct: 3 TPSAPHGDLTDMKAILAKVAAGNALNEPEAALAFDIIMSGNATPSQMGGFLMALRVRGET 62 Query: 76 ADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVK 135 DE+ A VM + A P+ A PD +D GTGGDG T N+ST AA+V+AA GVPV K Sbjct: 63 VDEITGAARVMRAKAIPVEA---PDGTIDTCGTGGDGSGTYNISTAAAVVIAACGVPVAK 119 Query: 136 HGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRRE 195 HGNRA SS SG AD L ALGV +D LV ++L + IGF APR H + R+ R E Sbjct: 120 HGNRAMSSKSGAADVLGALGVNLDCDMGLVRKALWDARIGFLMAPRHHLAMRNVGPTRVE 179 Query: 196 IGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRS-SVLVVHGDDGLDELT 254 +G T+FNLLGPL+NPA + L+G E +A V S + +VHG DGLDE+T Sbjct: 180 LGTRTIFNLLGPLSNPASAKRQLLGVYAKQWVEPLAHVLKRLGSEAAWIVHGSDGLDEIT 239 Query: 255 TTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRD 314 TT +T+ ++ G V +P G RA+ + L GGDA NA A+RA+ G +G RD Sbjct: 240 TTGPTTVAQLKDGEVTVFEIEPEQAGIFRARPELLKGGDAHVNAEAIRALFDGVQGAYRD 299 Query: 315 AVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWV 364 V+LNAA A+ ++ +A L +EG+ +A AID+GAA +L V Sbjct: 300 IVLLNAAAAL----HVAGKAGDL---KEGVEQARHAIDSGAARAVLQHLV 342 Lambda K H 0.318 0.132 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 357 Length adjustment: 29 Effective length of query: 341 Effective length of database: 328 Effective search space: 111848 Effective search space used: 111848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate AZOBR_RS07455 AZOBR_RS07455 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.12713.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-123 398.5 0.2 1.4e-123 398.3 0.2 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS07455 AZOBR_RS07455 anthranilate phosp Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS07455 AZOBR_RS07455 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 398.3 0.2 1.4e-123 1.4e-123 2 329 .. 19 343 .. 18 344 .. 0.98 Alignments for each domain: == domain 1 score: 398.3 bits; conditional E-value: 1.4e-123 TIGR01245 2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeesee 70 k++ ++ L+e ea+ +++ imsg+a+++q++ +l+alrv+get++ei+g+a+++r+ka ve+ + lcl|FitnessBrowser__azobra:AZOBR_RS07455 19 AKVAAGNALNEPEAALAFDIIMSGNATPSQMGGFLMALRVRGETVDEITGAARVMRAKAIPVEA--PDG 85 688999********************************************************88..69* PP TIGR01245 71 lvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsle 139 +D++GTGGDg+ t+NiSTa+a+v+aa+Gv+vaKhGnr++ssksG+aDvL algvnl+ ++ v+++l lcl|FitnessBrowser__azobra:AZOBR_RS07455 86 TIDTCGTGGDGSGTYNISTAAAVVIAACGVPVAKHGNRAMSSKSGAADVLGALGVNLDCDMGLVRKALW 154 ********************************************************************* PP TIGR01245 140 evgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgv 208 + igFl+AP++h a+++v p+R eLg+rt+fNlLGPL+nPa+ak+q+lGvy k+ ve la+vlk+lg+ lcl|FitnessBrowser__azobra:AZOBR_RS07455 155 DARIGFLMAPRHHLAMRNVGPTRVELGTRTIFNLLGPLSNPASAKRQLLGVYAKQWVEPLAHVLKRLGS 223 ********************************************************************* PP TIGR01245 209 kralvvhgedglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevleg 277 + a +vhg+dglDEi++tg+t+va+lkdge++ ++++pe+ g+ ra+ e lkgg+a+ nae++++++ g lcl|FitnessBrowser__azobra:AZOBR_RS07455 224 EAAWIVHGSDGLDEITTTGPTTVAQLKDGEVTVFEIEPEQAGIFRARPELLKGGDAHVNAEAIRALFDG 292 ****************************************************************88888 PP TIGR01245 278 kekkakrdivvlNaaaalyvagkakdlkegvelakeaiksgkalekleelva 329 + +a rdiv+lNaaaal vagka dlkegve+a++ai+sg+a ++l++lv+ lcl|FitnessBrowser__azobra:AZOBR_RS07455 293 VQ-GAYRDIVLLNAAAALHVAGKAGDLKEGVEQARHAIDSGAARAVLQHLVS 343 77.9********************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (357 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.84 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory