GapMind for Amino acid biosynthesis

 

Alignments for a candidate for ptransferase in Azospirillum brasilense Sp245

Align aspartate transaminase (EC 2.6.1.1); aspartate-prephenate aminotransferase (EC 2.6.1.78); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate AZOBR_RS12970 AZOBR_RS12970 aspartate aminotransferase

Query= BRENDA::Q02635
         (400 letters)



>FitnessBrowser__azobra:AZOBR_RS12970
          Length = 401

 Score =  584 bits (1506), Expect = e-171
 Identities = 288/396 (72%), Positives = 319/396 (80%)

Query: 1   MAFLADALSRVKPSATIAVSQKARELKAKGRDVIGLGAGEPDFDTPDNIKKAAIDAIDRG 60
           M+ +A  LSR+KPS TIAV+QKAREL A GRDVIGLGAGEPDFDTPDNIK AAI AI  G
Sbjct: 1   MSIIASRLSRIKPSPTIAVTQKARELAAAGRDVIGLGAGEPDFDTPDNIKDAAIKAIQAG 60

Query: 61  ETKYTPVSGIPELREAIAKKFKRENNLDYTAAQTIVGTGGKQILFNAFMATLNPGDEVVI 120
           +TKYT V G P L++AI  KF+REN L Y   Q  VG GGKQ+L+NA MATL PGDEV+I
Sbjct: 61  DTKYTAVDGTPALKKAICAKFERENGLKYAPDQITVGVGGKQVLYNALMATLTPGDEVII 120

Query: 121 PAPYWVSYPEMVALCGGTPVFVPTRQENNFKLKAEDLDRAITPKTKWFVFNSPSNPSGAA 180
           PAPYWVSYP+MV L  GTPVFV    E  FKL+  DL++AITPKTKW + NSPSNPSGAA
Sbjct: 121 PAPYWVSYPDMVELAEGTPVFVSCPAEQGFKLQPADLEKAITPKTKWLILNSPSNPSGAA 180

Query: 181 YSHEELKALTDVLMKHPHVWVLTDDMYEHLTYGDFRFATPVEVEPGLYERTLTMNGVSKA 240
           Y+ +E+KALTDVL+KHP VWV+TDDMYEHL Y    F TP +VEP LY+RTLT+NGVSK+
Sbjct: 181 YTRDEMKALTDVLVKHPQVWVMTDDMYEHLLYDGIEFVTPAQVEPALYDRTLTVNGVSKS 240

Query: 241 YAMTGWRIGYAAGPLHLIKAMDMIQGQQTSGAASIAQWAAVEALNGPQDFIGRNKEIFQG 300
           YAMTGWRIGYA GP  LIKAM +IQ Q TS   SIAQ AAVEALNGPQDFI     +F  
Sbjct: 241 YAMTGWRIGYAGGPKALIKAMGVIQSQSTSNPTSIAQAAAVEALNGPQDFIAERAAVFAQ 300

Query: 301 RRDLVVSMLNQAKGISCPTPEGAFYVYPSCAGLIGKTAPSGKVIETDEDFVSELLETEGV 360
           RRDLVVSMLNQAKGISCP PEGAFYVYPSCAG IGKT P GKVIETDEDFV+ LLE+EGV
Sbjct: 301 RRDLVVSMLNQAKGISCPKPEGAFYVYPSCAGTIGKTTPDGKVIETDEDFVTYLLESEGV 360

Query: 361 AVVHGSAFGLGPNFRISYATSEALLEEACRRIQRFC 396
           AVV GSAFGL P+FRISYATS   LEEAC+RIQR C
Sbjct: 361 AVVQGSAFGLAPHFRISYATSTEALEEACKRIQRAC 396


Lambda     K      H
   0.318    0.134    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 598
Number of extensions: 16
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 400
Length of database: 401
Length adjustment: 31
Effective length of query: 369
Effective length of database: 370
Effective search space:   136530
Effective search space used:   136530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory