GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvC in Azospirillum brasilense Sp245

Align acetohydroxyacid isomeroreductase (EC 1.1.1.86) (characterized)
to candidate AZOBR_RS06570 AZOBR_RS06570 ketol-acid reductoisomerase

Query= metacyc::MONOMER-18814
         (338 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS06570 AZOBR_RS06570 ketol-acid
           reductoisomerase
          Length = 339

 Score =  464 bits (1194), Expect = e-135
 Identities = 230/339 (67%), Positives = 271/339 (79%), Gaps = 1/339 (0%)

Query: 1   MKVFYDKDADLSLIKGKNVTIIGYGSQGHAHALNLKDSGV-NVTVGLRKSGASWNKAANA 59
           M+V+YD+DAD++LIKGK V I+GYGSQGHAHA NL+DSGV +V + LR   A+  KA  A
Sbjct: 1   MRVYYDRDADVNLIKGKKVVIVGYGSQGHAHANNLRDSGVKDVRIALRPGSATIKKAEAA 60

Query: 60  GLQVKEVAEAVKGADVVMILLPDEQIADVYKNEVHDNIKEGAALAFAHGFNVHYGAVIPR 119
           G  V    EA   ADVVMIL PDE  AD+Y++++  N+KEGAALAFAHG NVH+  + PR
Sbjct: 61  GFTVMAPGEAAAWADVVMILTPDELQADLYRDDLAKNLKEGAALAFAHGLNVHFNLIEPR 120

Query: 120 ADLDVIMIAPKAPGHTVRATYTQGGGVPHLIAVHQNKSGAARDIALSYATANGGGRAGII 179
           ADLDV MIAPK PGHTVR  Y +GGGVP L+AVHQN SG   DIALSYA+A GGGRAGII
Sbjct: 121 ADLDVFMIAPKGPGHTVRGEYQRGGGVPCLVAVHQNASGNGLDIALSYASAIGGGRAGII 180

Query: 180 ETNFREETETDLFGEQAVLCGGTVELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIY 239
           ET F+EE ETDLFGEQAVLCGG  ELIKAG+ETL EAGYAPEMAYFECLHE+KLIVDL+Y
Sbjct: 181 ETTFKEECETDLFGEQAVLCGGLTELIKAGYETLTEAGYAPEMAYFECLHEVKLIVDLMY 240

Query: 240 EGGIANMNYSISNNAEYGEYVTGPRVVTEETKKAMKQCLTDIQTGEYAKSFLLENKAGAP 299
           EGG+ANM YSISN AEYG+Y TGPR++T ETK  MK+ L DIQTG + + ++LE KAG P
Sbjct: 241 EGGMANMRYSISNTAEYGDYKTGPRIITPETKAEMKRVLEDIQTGRFVRDWMLECKAGQP 300

Query: 300 TLISRRRLTAEHQIEEVGAKLRAMMPWIAKNKMVDQSKN 338
           +  + RR  AEH IE+VG KLRAMMPWIA+ ++VD+SKN
Sbjct: 301 SFKATRRRNAEHSIEQVGEKLRAMMPWIAERRLVDKSKN 339


Lambda     K      H
   0.316    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 449
Number of extensions: 16
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 338
Length of database: 339
Length adjustment: 28
Effective length of query: 310
Effective length of database: 311
Effective search space:    96410
Effective search space used:    96410
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)

Align candidate AZOBR_RS06570 AZOBR_RS06570 (ketol-acid reductoisomerase)
to HMM TIGR00465 (ilvC: ketol-acid reductoisomerase (EC 1.1.1.86))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00465.hmm
# target sequence database:        /tmp/gapView.28019.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00465  [M=314]
Accession:   TIGR00465
Description: ilvC: ketol-acid reductoisomerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   5.3e-137  441.9   0.1   6.2e-137  441.7   0.1    1.0  1  lcl|FitnessBrowser__azobra:AZOBR_RS06570  AZOBR_RS06570 ketol-acid reducto


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__azobra:AZOBR_RS06570  AZOBR_RS06570 ketol-acid reductoisomerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  441.7   0.1  6.2e-137  6.2e-137       1     312 [.      14     327 ..      14     329 .. 0.99

  Alignments for each domain:
  == domain 1  score: 441.7 bits;  conditional E-value: 6.2e-137
                                 TIGR00465   1 lkgkkvaiiGyGsqGeaqalnlrdsgl.nvivglrkeaaswkkAeedGfkvltveeaikkadlimiLlp 68 
                                               +kgkkv+i+GyGsqG+a+a nlrdsg+ +v+++lr+++a++kkAe  Gf v+   ea++ ad++miL+p
  lcl|FitnessBrowser__azobra:AZOBR_RS06570  14 IKGKKVVIVGYGSQGHAHANNLRDSGVkDVRIALRPGSATIKKAEAAGFTVMAPGEAAAWADVVMILTP 82 
                                               689************************67**************************************** PP

                                 TIGR00465  69 DevqkevyeaeikpllkegkallfsHGfnivfkqivipkdvdvvlvAPKgpGalvReeykegrGvpsli 137
                                               De+q + y+ +++ +lkeg+al f+HG n++f+ i++++d+dv+++APKgpG++vR ey++g Gvp l+
  lcl|FitnessBrowser__azobra:AZOBR_RS06570  83 DELQADLYRDDLAKNLKEGAALAFAHGLNVHFNLIEPRADLDVFMIAPKGPGHTVRGEYQRGGGVPCLV 151
                                               ********************************************************************* PP

                                 TIGR00465 138 AveqdvtgeakeiAlayAkaiGgaragvlettFkeEvesDLfGEqavLcGglealikaafdtLveaGyq 206
                                               Av+q+++g++ +iAl+yA aiGg+rag++ettFkeE+e+DLfGEqavLcGgl++lika+++tL+eaGy+
  lcl|FitnessBrowser__azobra:AZOBR_RS06570 152 AVHQNASGNGLDIALSYASAIGGGRAGIIETTFKEECETDLFGEQAVLCGGLTELIKAGYETLTEAGYA 220
                                               ********************************************************************* PP

                                 TIGR00465 207 pelAyfeivhelklivdllkekGlelmrdavsntAklgalelr.eilkeelkkemqkilkeiqnGefak 274
                                               pe+Ayfe++he+klivdl++e+G+++mr ++sntA++g+++++ +i++ e+k+em+ +l++iq+G+f +
  lcl|FitnessBrowser__azobra:AZOBR_RS06570 221 PEMAYFECLHEVKLIVDLMYEGGMANMRYSISNTAEYGDYKTGpRIITPETKAEMKRVLEDIQTGRFVR 289
                                               ********************************************************************* PP

                                 TIGR00465 275 ewalekeagkpafeearkkekeqeiekvGkelralvka 312
                                               +w+le +ag+p+f+++r+++ e++ie+vG++lra++++
  lcl|FitnessBrowser__azobra:AZOBR_RS06570 290 DWMLECKAGQPSFKATRRRNAEHSIEQVGEKLRAMMPW 327
                                               ************************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (314 nodes)
Target sequences:                          1  (339 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 7.69
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory