Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate GFF938 Psest_0967 carbamoyl-phosphate synthase, small subunit
Query= SwissProt::P0A6F1 (382 letters) >FitnessBrowser__psRCH2:GFF938 Length = 382 Score = 533 bits (1372), Expect = e-156 Identities = 261/374 (69%), Positives = 299/374 (79%) Query: 5 ALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVG 64 A+L L DG+ F G +IGA G +GEVVFNT+MTGYQEILTDPSY++QIVTLTYPH+GN G Sbjct: 9 AILALADGSIFRGESIGADGQTIGEVVFNTAMTGYQEILTDPSYAKQIVTLTYPHVGNTG 68 Query: 65 TNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLRE 124 T D ES +V A GLVIRDLPLI+SN+R+ + L YLK + VAIA IDTR+LTR+LRE Sbjct: 69 TTPEDAESWKVWAAGLVIRDLPLISSNWRDKQPLPDYLKANGTVAIAGIDTRRLTRILRE 128 Query: 125 KGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEA 184 KGAQNGCI+AG + ALE AR+FPGL GMDLAKEV+ E Y W W L Sbjct: 129 KGAQNGCILAGSDATEEKALELARSFPGLKGMDLAKEVSVKERYEWRSSVWCLKDDGHAE 188 Query: 185 KKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGD 244 ELP+HVVA+D+G K NILRMLV RGCR+T++PAQT A + L +NPDGIFL+NGPGD Sbjct: 189 IPASELPYHVVAFDYGVKYNILRMLVARGCRVTVLPAQTPASEALALNPDGIFLANGPGD 248 Query: 245 PAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDVEKNV 304 P PCDYAI AIQ+ LETDIPVFGICLGHQLLALASGAKTVKM GHHG NHPV+D++ V Sbjct: 249 PEPCDYAIKAIQEVLETDIPVFGICLGHQLLALASGAKTVKMPNGHHGANHPVQDLKTGV 308 Query: 305 VMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAA 364 VMIT+QNHGFAVDEA+LPAN+R THKSLFDGTLQGI RTDK AFSFQGHPEASPGPHD A Sbjct: 309 VMITSQNHGFAVDEASLPANVRATHKSLFDGTLQGIERTDKAAFSFQGHPEASPGPHDVA 368 Query: 365 PLFDHFIELIEQYR 378 PLFD FIE + + R Sbjct: 369 PLFDRFIETMAKRR 382 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 527 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 382 Length adjustment: 30 Effective length of query: 352 Effective length of database: 352 Effective search space: 123904 Effective search space used: 123904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate GFF938 Psest_0967 (carbamoyl-phosphate synthase, small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.3164.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-145 470.7 0.0 1.7e-145 470.5 0.0 1.0 1 lcl|FitnessBrowser__psRCH2:GFF938 Psest_0967 carbamoyl-phosphate s Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF938 Psest_0967 carbamoyl-phosphate synthase, small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 470.5 0.0 1.7e-145 1.7e-145 1 360 [. 9 379 .. 9 380 .. 0.95 Alignments for each domain: == domain 1 score: 470.5 bits; conditional E-value: 1.7e-145 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaeskkikvkgl 76 a+l+l+dG++f+g+s+ga+++++GevvFnT+mtGYqEiltDpsY++qiv+ltyp++gn+g+++edaes k++++gl lcl|FitnessBrowser__psRCH2:GFF938 9 AILALADGSIFRGESIGADGQTIGEVVFNTAMTGYQEILTDPSYAKQIVTLTYPHVGNTGTTPEDAESWKVWAAGL 84 689************************************************************************* PP TIGR01368 77 vvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavistekse.keelvekakespkvkev 151 v+++l sn+r k+ L ++lk +g vai+g+DTR l++ lRekg+++++i + + + +e++ e a++ p +k++ lcl|FitnessBrowser__psRCH2:GFF938 85 VIRDLPLISSNWRDKQPLPDYLKANGTVAIAGIDTRRLTRILREKGAQNGCILAGSDAtEEKALELARSFPGLKGM 160 ***************************************************99877653778889999******** PP TIGR01368 152 nlvkevstkeayeleq.........k..akkegkklrvvvidlGvKenilreLvkrgvevtvvpadtsaeeikkln 216 +l+kevs+ke+ye+++ + + +++ ++vv++d+GvK nilr+Lv+rg++vtv+pa+t+a+e +ln lcl|FitnessBrowser__psRCH2:GFF938 161 DLAKEVSVKERYEWRSsvwclkddgHaeIPASELPYHVVAFDYGVKYNILRMLVARGCRVTVLPAQTPASEALALN 236 ***************977777665523344444449**************************************** PP TIGR01368 217 pdgillsnGPGdPaaveeaietvkklleakiPifGIclGhqllalalgaktyklkfGhrGaNhpvkdlktgrveit 292 pdgi+l+nGPGdP+ +++ai+ ++++le++iP+fGIclGhqllala+gakt+k+ Gh+GaNhpv+dlktg v+it lcl|FitnessBrowser__psRCH2:GFF938 237 PDGIFLANGPGDPEPCDYAIKAIQEVLETDIPVFGICLGHQLLALASGAKTVKMPNGHHGANHPVQDLKTGVVMIT 312 **************************************************************************** PP TIGR01368 293 sqNHgyavdeeslkeeelevthvnlnDgtveglehkelpvfsvQyHPeaspGphdteylFdefvelik 360 sqNHg+avde+sl+++ +++th++l+Dgt++g+e++++++fs Q HPeaspGphd + lFd+f+e+++ lcl|FitnessBrowser__psRCH2:GFF938 313 SQNHGFAVDEASLPAN-VRATHKSLFDGTLQGIERTDKAAFSFQGHPEASPGPHDVAPLFDRFIETMA 379 ************8866.************************************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (382 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.25 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory