Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate GFF2974 Psest_3030 phospho-2-dehydro-3-deoxyheptonate aldolase
Query= BRENDA::P00888 (356 letters) >FitnessBrowser__psRCH2:GFF2974 Length = 357 Score = 362 bits (929), Expect = e-105 Identities = 181/336 (53%), Positives = 235/336 (69%), Gaps = 4/336 (1%) Query: 15 QVLMTPEQLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCGPCSIHDPETALEYA 74 Q L +P L+ PLS A+I + R +I ++ GRDPRLLVV GPCS+HDP ALEYA Sbjct: 25 QPLPSPAVLRQRLPLSDALAARIDNDRNAIRTVLDGRDPRLLVVVGPCSLHDPVAALEYA 84 Query: 75 RRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLQIARKLLLEL 134 R ALA EVSD L LVMR Y EKPRTTVGWKGL+ DPH+DGS ++ GL ++R+L+L++ Sbjct: 85 ERLAALAPEVSDQLLLVMRAYVEKPRTTVGWKGLVYDPHLDGSGNMAEGLHLSRRLILDI 144 Query: 135 VNMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVGFKNGTDGSL 194 + GLP+ATE L P + Y DL W+AIGART+ESQ HRE+ SGL +PVGFKNGTDGSL Sbjct: 145 LETGLPIATELLQPLAAGYFDDLLGWAAIGARTSESQIHRELVSGLDLPVGFKNGTDGSL 204 Query: 195 ATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGGK-APNYSPADVAQCEKE 253 A +AMR+A PH+ GI+ G ALLQT+GNPD H++LRGG APNY A VA + Sbjct: 205 GIACDAMRSAEHPHQHFGIDDLGHPALLQTRGNPDTHLVLRGGHGAPNYDAASVAVARRA 264 Query: 254 MEQAGLRPSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGLMIESNIHEGNQSS 313 +E+ G+ P +MVDCSH NS K+ RQP V ESV+AQ G+ S+ G+M+ES++ +G Q Sbjct: 265 LEKQGIAPRIMVDCSHANSGKNPLRQPEVLESVIAQRLAGDASLRGVMLESHLFDGCQPL 324 Query: 314 EQPRSEMKYGVSVTDACISWEMTDALLREIHQDLNG 349 + ++YGVS+TD C+ W T+ +LR+ L G Sbjct: 325 S---AALRYGVSITDGCLGWTATEQMLRDAAHRLRG 357 Lambda K H 0.316 0.131 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 357 Length adjustment: 29 Effective length of query: 327 Effective length of database: 328 Effective search space: 107256 Effective search space used: 107256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate GFF2974 Psest_3030 (phospho-2-dehydro-3-deoxyheptonate aldolase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.31703.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-135 437.9 0.0 1.2e-135 437.7 0.0 1.0 1 lcl|FitnessBrowser__psRCH2:GFF2974 Psest_3030 phospho-2-dehydro-3-d Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF2974 Psest_3030 phospho-2-dehydro-3-deoxyheptonate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 437.7 0.0 1.2e-135 1.2e-135 8 338 .. 24 355 .. 17 357 .] 0.98 Alignments for each domain: == domain 1 score: 437.7 bits; conditional E-value: 1.2e-135 TIGR00034 8 idelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakrlkklaeklkddl 82 ++l +P+ l+++ pl+ + a+++ ++r++i +l+G+d+rllvv+GPcs+hdp aaleya+rl++la +++d+l lcl|FitnessBrowser__psRCH2:GFF2974 24 AQPLPSPAVLRQRLPLSDALAARIDNDRNAIRTVLDGRDPRLLVVVGPCSLHDPVAALEYAERLAALAPEVSDQL 98 57899********************************************************************** PP TIGR00034 83 eivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplatelldtispqyladllswgai 157 +vmr+y+ekPrttvGWkGl+ dP+l++s ++ +Gl+++r+l+ld+ e+glp+atell++ ++ y+ dll w+ai lcl|FitnessBrowser__psRCH2:GFF2974 99 LLVMRAYVEKPRTTVGWKGLVYDPHLDGSGNMAEGLHLSRRLILDILETGLPIATELLQPLAAGYFDDLLGWAAI 173 *************************************************************************** PP TIGR00034 158 GarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsvtkaGqvaivetkGnedghiilrGGk 232 Gart+esq+hrel sgl lpvgfkngtdGsl +a da+r+a+++h +++++ G+ a+++t+Gn+d+h++lrGG+ lcl|FitnessBrowser__psRCH2:GFF2974 174 GARTSESQIHRELVSGLDLPVGFKNGTDGSLGIACDAMRSAEHPHQHFGIDDLGHPALLQTRGNPDTHLVLRGGH 248 *************************************************************************** PP TIGR00034 233 k.pnydaedvaevkeelekaglkeelmidfshgnsnkdykrqlevaesvveqiaeGekaiiGvmiesnleeGnqs 306 pnyda++va +++ lek g +++m+d+sh+ns k+ rq+ev esv++q G+ ++ Gvm+es+l +G q lcl|FitnessBrowser__psRCH2:GFF2974 249 GaPNYDAASVAVARRALEKQGIAPRIMVDCSHANSGKNPLRQPEVLESVIAQRLAGDASLRGVMLESHLFDGCQP 323 99************************************************************************* PP TIGR00034 307 lkeelkyGksvtdacigwedteallrklaeav 338 l+++l yG+s+td c+gw te++lr+ a+ + lcl|FitnessBrowser__psRCH2:GFF2974 324 LSAALRYGVSITDGCLGWTATEQMLRDAAHRL 355 **************************988765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (357 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.39 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory