Align cystathionine beta-synthase; EC 4.2.1.22 (characterized)
to candidate GFF1816 Psest_1855 cysteine synthase A
Query= CharProtDB::CH_122414 (533 letters) >FitnessBrowser__psRCH2:GFF1816 Length = 324 Score = 226 bits (576), Expect = 1e-63 Identities = 137/319 (42%), Positives = 189/319 (59%), Gaps = 9/319 (2%) Query: 21 IGNTPLVRLNKLPQNLGINATVYAKLEYFNAGGSVKDRIALRMIEEAERSGRIKPGDTLI 80 IGNTPLV +N+L T+ AK+E N SVK RI MI +AE SGRIKPG TL+ Sbjct: 12 IGNTPLVMINRLGPK---GVTIMAKIEGRNPAYSVKCRIGAGMIWDAEDSGRIKPGMTLV 68 Query: 81 EPTSGNTGIGLALVAAVKGYKTIITLPEKMSAEKVSVLRALNATIIRT-PNEAAYDSPES 139 EPTSGNTGIGLA VAA +GYK ++T+P MS E+ VL+AL A ++ T P + + E Sbjct: 69 EPTSGNTGIGLAFVAAARGYKLMLTMPASMSLERRKVLKALGAELVLTEPAKGMKGAIEK 128 Query: 140 HIGVAKRLEKELPNAHILDQYGNENNPLAHELGTAQEIWSQTKGQIKAIVAGAGTGGTIT 199 +A ++ ++ Q+ N +NP HE T EIW+ T G I +VAG GTGGTIT Sbjct: 129 AAEIAASNPEQY---YMPQQFENPSNPAIHEKTTGPEIWNDTDGSIDVLVAGVGTGGTIT 185 Query: 200 GLSRGLKK-HNSNVQVIAADPQGSILALPAALNEEHANEPYKVEGIGYDFIPQVLDQHAV 258 G+SR +K + +A +P S + +E P+K++GIG F+P+ LD V Sbjct: 186 GVSRYIKNTKGKQIISVAVEPTSSPVISQTLAGDEVKPSPHKIQGIGAGFVPKNLDLSMV 245 Query: 259 DKWYKTDDKESFQYARRLIAEEGLLVGGSSGSAIAALVKAARDNMFKEGDVVVVILPDSI 318 D+ DD+E+ Q A RL+ EEG+L G S G+A+AA V+ A + +G +VVILPDS Sbjct: 246 DRVELVDDEEAKQMALRLMREEGILCGISCGAAMAAAVRLA-ERPEMQGKNIVVILPDSG 304 Query: 319 RSYLTKFADDDWLAANDLL 337 YL+ D + +L+ Sbjct: 305 ERYLSSMLFSDMFSEQELV 323 Lambda K H 0.314 0.131 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 533 Length of database: 324 Length adjustment: 31 Effective length of query: 502 Effective length of database: 293 Effective search space: 147086 Effective search space used: 147086 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory