Align [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase (EC 2.5.1.113); O-phosphoserine sulfhydrylase (EC 2.5.1.65) (characterized)
to candidate GFF1816 Psest_1855 cysteine synthase A
Query= BRENDA::P9WP53 (323 letters) >FitnessBrowser__psRCH2:GFF1816 Length = 324 Score = 171 bits (434), Expect = 2e-47 Identities = 111/322 (34%), Positives = 172/322 (53%), Gaps = 26/322 (8%) Query: 9 QALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAEADGLL 68 +++GNTPLV + RL P+ V + AK+E RNP S+K R MI AE G + Sbjct: 10 RSIGNTPLVMINRLGPKG--------VTIMAKIEGRNPAYSVKCRIGAGMIWDAEDSGRI 61 Query: 69 RPGATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQIIFSAAEGG 128 +PG T++EPTSGNTGI LA A +GY+L+ MP + S+ERR++L+ GA+++ + G Sbjct: 62 KPGMTLVEPTSGNTGIGLAFVAAARGYKLMLTMPASMSLERRKVLKALGAELVLTEPAKG 121 Query: 129 SNTAVATAKELAATNP-SWVMLYQYGNPANTDSHYCGTGPELLADLP-EITHFVAGLGTT 186 A+ A E+AA+NP + M Q+ NP+N H TGPE+ D I VAG+GT Sbjct: 122 MKGAIEKAAEIAASNPEQYYMPQQFENPSNPAIHEKTTGPEIWNDTDGSIDVLVAGVGTG 181 Query: 187 GTLMGTGRFLREHVANVKI-VAAEPRYGEGV-------------YALRNMDEGFVPELYD 232 GT+ G R+++ I VA EP + + ++ + GFVP+ D Sbjct: 182 GTITGVSRYIKNTKGKQIISVAVEPTSSPVISQTLAGDEVKPSPHKIQGIGAGFVPKNLD 241 Query: 233 PEILTARYSVGAVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIALV 292 ++ V +A + L+ EGI GIS GA + AA+ + G+ +I ++ Sbjct: 242 LSMVDRVELVDDEEAKQMALRLMREEGILCGISCGAAMAAAVRLAERPEMQGK--NIVVI 299 Query: 293 VADAGWKYLSTGAYAGSLDDAE 314 + D+G +YLS+ ++ + E Sbjct: 300 LPDSGERYLSSMLFSDMFSEQE 321 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 324 Length adjustment: 28 Effective length of query: 295 Effective length of database: 296 Effective search space: 87320 Effective search space used: 87320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory