Align Probable serine acetyltransferase; SAT; EC 2.3.1.30 (uncharacterized)
to candidate GFF855 Psest_0869 Acetyltransferase (isoleucine patch superfamily)
Query= curated2:P23145 (269 letters) >FitnessBrowser__psRCH2:GFF855 Length = 182 Score = 60.8 bits (146), Expect = 2e-14 Identities = 56/166 (33%), Positives = 75/166 (45%), Gaps = 28/166 (16%) Query: 31 YPGVHAIMLYRLAHRLW--RPNALPRPAAVVRARLVSN--VDIHPGAVIGARFFIDHGA- 85 YPG I+ + A + W R NA + R L++ + GAVI F D+G Sbjct: 16 YPGDPEILADQAAAKAWMVRYNAALAASPDERRALLAERLASVGAGAVIRPPFHCDYGYN 75 Query: 86 ------------CVV-------IGETAEIGRDVTLYHGV----TLGGTTGAKGKRHPTLG 122 CV+ IG A+IG V LY +G + R +G Sbjct: 76 IHLGEGAFLNFNCVILDVVEVHIGAGAQIGPAVQLYTADHPRDPEARRSGVEFGRPINIG 135 Query: 123 DVVLVGAGAKILGPITIGANARVGANSVVVQDVPEGCTVVGIPGKV 168 V VG GA IL +TIG +A +GA SVV +DVP G TVVG P ++ Sbjct: 136 RNVWVGGGAIILPGVTIGDDAVIGAGSVVTRDVPAGATVVGNPARI 181 Lambda K H 0.321 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 182 Length adjustment: 22 Effective length of query: 247 Effective length of database: 160 Effective search space: 39520 Effective search space used: 39520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory