Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate GFF1816 Psest_1855 cysteine synthase A
Query= BRENDA::P0ABK5 (323 letters) >FitnessBrowser__psRCH2:GFF1816 Length = 324 Score = 452 bits (1164), Expect = e-132 Identities = 229/325 (70%), Positives = 269/325 (82%), Gaps = 3/325 (0%) Query: 1 MSKIFEDNSLTIGHTPLVRLNRIG--NGRILAKVESRNPSFSVKCRIGANMIWDAEKRGV 58 MS+IF DN+ +IG+TPLV +NR+G I+AK+E RNP++SVKCRIGA MIWDAE G Sbjct: 1 MSRIFADNARSIGNTPLVMINRLGPKGVTIMAKIEGRNPAYSVKCRIGAGMIWDAEDSGR 60 Query: 59 LKPGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAK 118 +KPG+ LVEPTSGNTGI LA+VAAARGYKL LTMP +MS+ERRK+LKALGA LVLTE AK Sbjct: 61 IKPGMTLVEPTSGNTGIGLAFVAAARGYKLMLTMPASMSLERRKVLKALGAELVLTEPAK 120 Query: 119 GMKGAIQKAEEIVASNPEKYLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFIAGVGT 178 GMKGAI+KA EI ASNPE+Y + QQF NP+NP IHEKTTGPEIW DTDG +DV +AGVGT Sbjct: 121 GMKGAIEKAAEIAASNPEQYYMPQQFENPSNPAIHEKTTGPEIWNDTDGSIDVLVAGVGT 180 Query: 179 GGTLTGVSRYIKGTKGKTDLISVAVEPTDSPVIAQALAGEEIKPGPHKIQGIGAGFIPAN 238 GGT+TGVSRYIK TKGK +ISVAVEPT SPVI+Q LAG+E+KP PHKIQGIGAGF+P N Sbjct: 181 GGTITGVSRYIKNTKGK-QIISVAVEPTSSPVISQTLAGDEVKPSPHKIQGIGAGFVPKN 239 Query: 239 LDLKLVDKVIGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDESFTNKNIVVI 298 LDL +VD+V + +EEA A RLM EEGIL GIS GAA+AAA++L E KNIVVI Sbjct: 240 LDLSMVDRVELVDDEEAKQMALRLMREEGILCGISCGAAMAAAVRLAERPEMQGKNIVVI 299 Query: 299 LPSSGERYLSTALFADLFTEKELQQ 323 LP SGERYLS+ LF+D+F+E+EL Q Sbjct: 300 LPDSGERYLSSMLFSDMFSEQELVQ 324 Lambda K H 0.313 0.133 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 324 Length adjustment: 28 Effective length of query: 295 Effective length of database: 296 Effective search space: 87320 Effective search space used: 87320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
Align candidate GFF1816 Psest_1855 (cysteine synthase A)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.9223.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-141 454.7 0.4 8.1e-141 454.5 0.4 1.0 1 lcl|FitnessBrowser__psRCH2:GFF1816 Psest_1855 cysteine synthase A Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF1816 Psest_1855 cysteine synthase A # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 454.5 0.4 8.1e-141 8.1e-141 2 298 .] 9 313 .. 8 313 .. 0.99 Alignments for each domain: == domain 1 score: 454.5 bits; conditional E-value: 8.1e-141 TIGR01139 2 seliGntPlvrLnlaeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGntGialamva 76 ++ iGntPlv +n+ ++ + +++k+e +nP++svk+ri++ mi+dae++g +k+g t+ve+tsGntGi+la+va lcl|FitnessBrowser__psRCH2:GFF1816 9 ARSIGNTPLVMINRLGPKGVTIMAKIEGRNPAYSVKCRIGAGMIWDAEDSGRIKPGMTLVEPTSGNTGIGLAFVA 83 578**********99999********************************************************* PP TIGR01139 77 aargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkylllkqfenpanpeihrkt 151 aargykl+ltmp++mslerrk+lka+GaelvLt++a+gmkgaieka e+++++p++y++++qfenp+np+ih+kt lcl|FitnessBrowser__psRCH2:GFF1816 84 AARGYKLMLTMPASMSLERRKVLKALGAELVLTEPAKGMKGAIEKAAEIAASNPEQYYMPQQFENPSNPAIHEKT 158 *************************************************************************** PP TIGR01139 152 tapeilkdldgkldafvagvGtGGtitGvgevlkekkp.dikvvavePaespvlsgg......kpgphkiqGiga 219 t+pei++d+dg++d++vagvGtGGtitGv++++k++k+ +i +vaveP++spv+s++ kp phkiqGiga lcl|FitnessBrowser__psRCH2:GFF1816 159 TGPEIWNDTDGSIDVLVAGVGTGGTITGVSRYIKNTKGkQIISVAVEPTSSPVISQTlagdevKPSPHKIQGIGA 233 ************************************9989****************999**************** PP TIGR01139 220 gfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalkvakkle.kdkkivvilpdtgerYl 293 gf+Pk+Ld +++d+v v+deea ++a rl++eeGil Gis Gaa+aaa+++a+++e ++k+ivvilpd+gerYl lcl|FitnessBrowser__psRCH2:GFF1816 234 GFVPKNLDLSMVDRVELVDDEEAKQMALRLMREEGILCGISCGAAMAAAVRLAERPEmQGKNIVVILPDSGERYL 308 *********************************************************9***************** PP TIGR01139 294 staLf 298 s Lf lcl|FitnessBrowser__psRCH2:GFF1816 309 SSMLF 313 **998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (324 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.09 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory