Align Histidinol-phosphatase; HolPase; EC 3.1.3.15; Histidinol-phosphate phosphatase (uncharacterized)
to candidate GFF2730 Psest_2784 Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family
Query= curated2:P56160 (259 letters) >FitnessBrowser__psRCH2:GFF2730 Length = 267 Score = 96.3 bits (238), Expect = 6e-25 Identities = 76/255 (29%), Positives = 121/255 (47%), Gaps = 14/255 (5%) Query: 8 ALELAEKAGKLTLDYFGRR-SLQVFSKRDDTP--VTEADRNAEELIRQGISAKFPDDGLF 64 A LA +A +L +DY+ +R +L V K D V+ AD++ E+ IR ++ +FP DG Sbjct: 13 AKSLALEAAQLGMDYYRQRETLDVEHKGSDQQDVVSIADKSIEDFIRARLAEQFPQDGFL 72 Query: 65 GEEFDEHPSGNGRRWIIDPIDGTRSFIHGVPLYGVMIALEVEGAMQLGVINFPALGELYQ 124 GEE W+IDPIDGT F++G+ + V I L ++G +G I P EL+ Sbjct: 73 GEESGSADLKARCVWVIDPIDGTACFVNGLHNWCVSIGLLIDGEPHIGAIADPNHDELFH 132 Query: 125 AERGSGAFMNGSPVQVSAIAE-----NSASTVVFTEKEYLLDPPSNHPVDQLRIDAGL-V 178 G GA++N + ++ SA A T KE+ + +++L + G+ + Sbjct: 133 GCVGRGAYVNQTRLKASAATHVREGLTGAGTFHPRGKEHFIP-----FLEKLLAEGGMFI 187 Query: 179 RGWGDCYGHMLVASGRAEVAVDKIMSPWDCAAVIPIVEEAGGCCFDYRGRQSIIDGEGLV 238 R VA+GR + + WDC A + +V EAG D+ ++ G + Sbjct: 188 RNGSGALMTAYVAAGRLIGYYETELKSWDCLAGLVLVAEAGALRNDFFRDDGLLRGNPYL 247 Query: 239 SANNAMGRNLIAAIG 253 A + R L IG Sbjct: 248 VAAPGVYRQLSELIG 262 Lambda K H 0.319 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 267 Length adjustment: 25 Effective length of query: 234 Effective length of database: 242 Effective search space: 56628 Effective search space used: 56628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory