Align Acetate--CoA ligase CCL3; HlCCL3; 2-methylbutanoate--CoA ligase CCL4; 2-methylpropanoate--CoA ligase CCL4; Butanoate--CoA ligase CCL3; Hexanoate--CoA ligase CCL3; Isovalerate--CoA ligase CCL3; Pentanoate--CoA ligase CCL3; Propionate--CoA ligase CCL3; EC 6.2.1.1; EC 6.2.1.-; EC 6.2.1.17 (characterized)
to candidate GFF2429 Psest_2477 Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II
Query= SwissProt::M4IS88 (568 letters) >FitnessBrowser__psRCH2:GFF2429 Length = 542 Score = 156 bits (394), Expect = 2e-42 Identities = 160/552 (28%), Positives = 241/552 (43%), Gaps = 54/552 (9%) Query: 27 LERAATVHPTRTSVIHGSRHYTWLQTYHRCRQFASALNNHSIGLGST----VAVIAPNVP 82 L+R A P + ++ + R +++ Q R A+ + NH + LG + VA N Sbjct: 20 LQRIAMRSPEQIALQYRERRWSF-QALDRA---ANRVANHLLALGLSKADRVAAYGKNSD 75 Query: 83 ALYEAHFAVPMAGAVVNCVNIRLNASTIAFLLGHSSAAAVMVDQEFFSLAEE--ALKILA 140 A A AG + VN L +A++L S A A+ VD L + A + LA Sbjct: 76 AYLILWLACTRAGLIHVPVNYSLTEHELAYVLDQSGARALFVDDSLKGLVDRIPAQRQLA 135 Query: 141 QESKSHYKPPLLVVIGDESCDPKTLEYALKTGAIEYEKFLEGGDPEFDWKPPED--EWQS 198 H +E+ ++ + TG+ D P D E Sbjct: 136 IRGSLH---------SNETTSDRSDILRIATGSA------------CDLPPEVDIAETDV 174 Query: 199 ISLGYTSGTTASPKGVVLSHRGAYLMSLSASVVWGINEGAIYLWTLPMFHCNGWCYTWGM 258 + + YTSGTT+ PKG + SHR S + I L LP++H Sbjct: 175 VQILYTSGTTSDPKGAMHSHRSLMTEYSSCLLHLDIKASDRCLAALPLYHSAQMHVFTMP 234 Query: 259 AAFCGTNICLRQV-TAKGVYSAIAKYGVTHFCAAPVVLNTIVNAPPEEAIIPLPHLVHVM 317 A G CL T + + + + F A P V ++ E+ + V + Sbjct: 235 ALLAGAFSCLTDTPTPEEILRLLKTEQLNSFFAPPTVWIALLRH--EQFVEAQLRHVQKL 292 Query: 318 TAGAAPPPSVLFAMSEKGFKVAHTYGLSETYGPSTICAWKPEWDSLPPIKQARLNARQGV 377 GA+ P + E G ++ + GL YG S I P L P + G Sbjct: 293 YYGASIMPEPI--ARELGARLPQS-GLYNCYGQSEIA---PLATVLTPEEHRERPTSCG- 345 Query: 378 RYIALEGLDVVDTKTMKPVPADGTTMGEIVMRGNAVMKGYLKNPKANEESFADGWFHSGD 437 R ++ ++D T + A G GE+V R +M GY + P E+FADGWFHSGD Sbjct: 346 RPVSNVLTRIIDPSTGEEC-APGVA-GELVHRSPQLMVGYWEKPAETAEAFADGWFHSGD 403 Query: 438 LAVKHPDGYIEIKDRSKDIIISGGENISSLEVENTLYLHPAVLEVSVVARPDERWGESPC 497 L + GYI I DR KDI+ +GG ++S +VE LY HP V EV+V+ PD++W E+ Sbjct: 404 LGYRDAQGYIWIVDRIKDIVNTGGVLVASRDVEEALYRHPHVAEVAVIGVPDQKWIEAIA 463 Query: 498 AFVTLKPNIDKSNEQVLAEDIIKFCKSKMPAYWVPKSVVF-GPLPKTATGKIQKHVLRAK 556 A V L K N + A+ ++ ++ + + VPK V F LPK ++GK+ K VLR Sbjct: 464 AVVVL-----KQNATLDAQALLHHARAHLAPFKVPKHVHFVEQLPKNSSGKLLKRVLRV- 517 Query: 557 AKEMGALKKSNL 568 + GA +S+L Sbjct: 518 --QFGASARSSL 527 Lambda K H 0.318 0.134 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 785 Number of extensions: 41 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 568 Length of database: 542 Length adjustment: 36 Effective length of query: 532 Effective length of database: 506 Effective search space: 269192 Effective search space used: 269192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory