GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvE in Pseudomonas stutzeri RCH2

Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate GFF1947 Psest_1990 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs

Query= BRENDA::A0A060PQX5
         (417 letters)



>lcl|FitnessBrowser__psRCH2:GFF1947 Psest_1990 Transcriptional
           regulators containing a DNA-binding HTH domain and an
           aminotransferase domain (MocR family) and their
           eukaryotic orthologs
          Length = 390

 Score =  256 bits (653), Expect = 1e-72
 Identities = 150/396 (37%), Positives = 220/396 (55%), Gaps = 15/396 (3%)

Query: 19  EKYFSKKALGMKASEVRELLKLVESSDVISLAGGLPAPETFPVEIIAEITKEVLEKHAAQ 78
           E  FS++   +K+S +RE+L   +  +V+S AGGLPA    P    AE+         A 
Sbjct: 2   EMAFSERITRLKSSLIREILAAAQRPEVMSFAGGLPAEAMLPTVDWAELP--------AS 53

Query: 79  ALQYGTTKGFTPLRLALAEWMRKRYDIPISKVDIMITSGSQQALDLIGRVFINPGDIVVV 138
             QYG ++G   LR A+A   R    +P     ++I SGSQQ LDL  ++FI+ G  V+V
Sbjct: 54  MGQYGMSEGEPALREAIAAQARA-LGVPCEASQVLIVSGSQQTLDLASKLFIDVGTEVLV 112

Query: 139 EAPTYLAALQAFKYYEPEFVQIPLDDEGMRVDLLEEKLQELEKEGKKVKLVYTIPTFQNP 198
           EAPTYLAALQ+F+ +    + +P   +G  +  L   L++           Y IPTFQNP
Sbjct: 113 EAPTYLAALQSFQLFGAHCLAVPQQADGPDLAALRTTLEQ-----HTPAFAYLIPTFQNP 167

Query: 199 AGVTMSEKRRKRLLELASEYDFLIVEDNPYGELRYSGEPVKPIKAWDDEGRVMYLGTFSK 258
           + V  SE +R  +  L  E+   ++ED PY EL +     +PI +       +Y GT SK
Sbjct: 168 SAVRYSEDKRDAVAALLDEFGVTLLEDEPYRELVFDQGSARPIVSRLKRASWIYTGTVSK 227

Query: 259 ILAPGFRIGWIAAEPHLIRKLEIAKQSVDLCTNPFSQVIAWKYVEGGHLDNHIPNIIEFY 318
            L PG R+G++ A P L   L   KQS DL TN   Q  A +++   H   H+  + EFY
Sbjct: 228 TLLPGLRVGYLIASPDLFPYLLRLKQSADLHTNRIGQWQALQWLGSDHYQAHLEQLREFY 287

Query: 319 KPRRDAMLKALEEFMPEGVRWTKPEGGMFVWVTLPEGIDTKLMLEKAVAKGVAYVPGEAF 378
           + RRDAM  AL+E   +   W  P+GG+F W+TL + +DT+ +L +A+A+ V ++PGE F
Sbjct: 288 RVRRDAMQAALDEHFSDLATWELPQGGLFFWLTLKQPLDTRTLLNQALAEDVVFMPGEPF 347

Query: 379 FAHRDVK-NTMRLNFTYVPEEKIREGIKRLAETIKE 413
           F   D     +RLNF++V  E++ EG+ RLA+ I+E
Sbjct: 348 FVDPDANPGYLRLNFSHVAGERMAEGLCRLAKVIRE 383


Lambda     K      H
   0.318    0.137    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 415
Number of extensions: 19
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 417
Length of database: 390
Length adjustment: 31
Effective length of query: 386
Effective length of database: 359
Effective search space:   138574
Effective search space used:   138574
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory