Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate GFF2666 Psest_2719 acetylornithine and succinylornithine aminotransferases/succinylornithine transaminase family
Query= BRENDA::Q93R93 (395 letters) >FitnessBrowser__psRCH2:GFF2666 Length = 406 Score = 268 bits (685), Expect = 2e-76 Identities = 155/376 (41%), Positives = 215/376 (57%), Gaps = 15/376 (3%) Query: 32 VRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQTLPTPMRGE 91 VRG G+RVWD G E +D GG V LGH +P +V A+ QA L + Sbjct: 29 VRGLGSRVWDQSGRELVDFAGGIAVNALGHAHPAMVAALTEQAGKLWHISNIYTNEPALR 88 Query: 92 FYRTLTAILPPELNRVFPVNSGTEANEAALKFARAHT----GRKKF--VAAMRGFSGRTM 145 + L A + R F NSG EANEAA K AR + G +KF ++A+ F GRT+ Sbjct: 89 LAKKLVAATFAD--RAFFCNSGAEANEAAFKLARRYAHDVYGPQKFEIISALNSFHGRTL 146 Query: 146 GSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEETAAVILEPVQGEGGVRPATP 205 +++V + KY + F P +E + +PYND+EALK A+ ++T AV+LEP+QGE G+ P Sbjct: 147 FTVTVGGQSKYSDGFGPKIEGITHVPYNDLEALKAAISDKTCAVVLEPIQGESGILPGEQ 206 Query: 206 EFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGGVPLGVA 265 +L AR++ E ALLI DE+QTGMGRTG+ FA+ H+GI PDILT AK+LGGG P+G Sbjct: 207 AYLEGARQLCNEHNALLIFDEVQTGMGRTGELFAYMHYGITPDILTNAKSLGGGFPIGAM 266 Query: 266 VMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIP 325 + E+A + G HGTT+GGNPLA A A + + + E F +L I Sbjct: 267 LTTNEIAAHLSVGTHGTTYGGNPLACAVAEAVVDIVNTPEVLEGVKAKHERFKARLTQIG 326 Query: 326 S--PKIREVRGMGLMVGLEL----KEKAAPYIARLEKEHRVLALQAGPTVIRFLPPLVIE 379 VRG GL++G L K KA + A EKE ++ LQAGP V+R P LVI+ Sbjct: 327 ERYGVFSLVRGRGLLIGCVLSDAWKGKAGAFCAAAEKE-ALMVLQAGPDVVRLAPSLVID 385 Query: 380 KEDLERVVEAVRAVLA 395 + D++ ++ + +A Sbjct: 386 QADIDEGLDRLERAVA 401 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 406 Length adjustment: 31 Effective length of query: 364 Effective length of database: 375 Effective search space: 136500 Effective search space used: 136500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory