Align L-2-aminoadipate aminotransferase monomer (EC 2.6.1.39) (characterized)
to candidate GFF1947 Psest_1990 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs
Query= metacyc::MONOMER-6727 (397 letters) >FitnessBrowser__psRCH2:GFF1947 Length = 390 Score = 248 bits (633), Expect = 2e-70 Identities = 149/390 (38%), Positives = 220/390 (56%), Gaps = 18/390 (4%) Query: 9 AFGKSAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKEEAAEAAARILREKGEVAL 68 AF + R+++S IRE+L QRP ++SFAGGLPA + P + AE A + Sbjct: 4 AFSERITRLKSSLIREILAAAQRPEVMSFAGGLPAEAMLPTVDWAELPASMG-------- 55 Query: 69 QYSPTEGYAPLRAFVAEW---IGVRPE--EVLITTGSQQALDLVGKVFLDEGSPVLLEAP 123 QY +EG LR +A +GV E +VLI +GSQQ LDL K+F+D G+ VL+EAP Sbjct: 56 QYGMSEGEPALREAIAAQARALGVPCEASQVLIVSGSQQTLDLASKLFIDVGTEVLVEAP 115 Query: 124 SYMGAIQAFRLQGPRFLTVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLP 183 +Y+ A+Q+F+L G L VP +GPDL AL L++ P F YLIP+FQNP+ Sbjct: 116 TYLAALQSFQLFGAHCLAVPQQADGPDLAALRTTLEQHTPAFAYLIPTFQNPSAVRYSED 175 Query: 184 ARKRLLQMVMERGLVVVEDDAYRELYFGEARLPSLFELAREAGYPGVIYLGSFSKVLSPG 243 R + ++ E G+ ++ED+ YREL F + + + A + IY G+ SK L PG Sbjct: 176 KRDAVAALLDEFGVTLLEDEPYRELVFDQGSARPIVSRLKRASW---IYTGTVSKTLLPG 232 Query: 244 LRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHELL-KEGFSERLERVRRVYREKAQ 302 LRV + +A P+ L++ KQ ADLHT + Q + L + + LE++R YR + Sbjct: 233 LRVGYLIASPDLFPYLLRLKQSADLHTNRIGQWQALQWLGSDHYQAHLEQLREFYRVRRD 292 Query: 303 AMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVAFVPGGPFFAN-G 361 AM ALD + P+GG+F W+ L + L L +AL E+V F+PG PFF + Sbjct: 293 AMQAALDEHFSDLATWELPQGGLFFWLTLKQPLDTRTLLNQALAEDVVFMPGEPFFVDPD 352 Query: 362 GGENTLRLSYATLDREGIAEGVRRLGRALK 391 LRL+++ + E +AEG+ RL + ++ Sbjct: 353 ANPGYLRLNFSHVAGERMAEGLCRLAKVIR 382 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 390 Length adjustment: 31 Effective length of query: 366 Effective length of database: 359 Effective search space: 131394 Effective search space used: 131394 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory