GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asp-kinase in Pseudomonas stutzeri RCH2

Align Aspartate kinase Ask_LysC; Aspartokinase; EC 2.7.2.4 (characterized)
to candidate GFF2932 Psest_2988 aspartate kinase, monofunctional class

Query= SwissProt::A4VJB4
         (412 letters)



>FitnessBrowser__psRCH2:GFF2932
          Length = 412

 Score =  778 bits (2008), Expect = 0.0
 Identities = 408/412 (99%), Positives = 410/412 (99%)

Query: 1   MALIVQKFGGTSVGTVERIEQVAEKVKKFRDGGDDIVVVVSAMSGETNRLIDLAKQISEQ 60
           MALIVQKFGGTSVGTVERIEQVAEKVKKFR+GGDDIVVVVSAMSGETNRLIDLAKQISEQ
Sbjct: 1   MALIVQKFGGTSVGTVERIEQVAEKVKKFREGGDDIVVVVSAMSGETNRLIDLAKQISEQ 60

Query: 61  PVPRELDVMVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSAHTKARILQIDAQR 120
           PVPRELDVMVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSAHTKARILQID QR
Sbjct: 61  PVPRELDVMVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSAHTKARILQIDGQR 120

Query: 121 IQRDIKAGRVVVVAGFQGVDEKGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT 180
           IQRDIKAGRVVVVAGFQGVDEKGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT
Sbjct: 121 IQRDIKAGRVVVVAGFQGVDEKGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYT 180

Query: 181 TDPRVVAKAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYSVPLRVLHSFQEGPGTLI 240
           TDPRVVAKAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYSVPLRVLHSFQEGPGTLI
Sbjct: 181 TDPRVVAKAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYSVPLRVLHSFQEGPGTLI 240

Query: 241 TLDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANVEVDMIVQNVAH 300
           TLDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANVEVDMIVQNVAH
Sbjct: 241 TLDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANVEVDMIVQNVAH 300

Query: 301 DNTTDFTFTVHRNDYNNALQVLQGIAAEMGAREAIGDTNIAKVSIVGVGMRSHAGVASRM 360
           DNTTDFTFTVHRNDYNNALQVLQGIAAEMGARE IGDT+IAKVSIVGVGMRSHAGVASRM
Sbjct: 301 DNTTDFTFTVHRNDYNNALQVLQGIAAEMGAREVIGDTDIAKVSIVGVGMRSHAGVASRM 360

Query: 361 FEALAKENINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPAGNTAE 412
           FEALAKENINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPAGNTAE
Sbjct: 361 FEALAKENINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPAGNTAE 412


Lambda     K      H
   0.317    0.133    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 726
Number of extensions: 15
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 412
Length of database: 412
Length adjustment: 31
Effective length of query: 381
Effective length of database: 381
Effective search space:   145161
Effective search space used:   145161
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

Align candidate GFF2932 Psest_2988 (aspartate kinase, monofunctional class)
to HMM TIGR00656 (aspartate kinase, monofunctional class (EC 2.7.2.4))

Software error:

../bin/blast/fastacmd -i /tmp/list.30939.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.30939.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.