Align homoserine dehydrogenase (EC 1.1.1.3); aspartate kinase (EC 2.7.2.4) (characterized)
to candidate GFF2932 Psest_2988 aspartate kinase, monofunctional class
Query= BRENDA::Q9WZ17 (739 letters) >FitnessBrowser__psRCH2:GFF2932 Length = 412 Score = 344 bits (882), Expect = 6e-99 Identities = 185/403 (45%), Positives = 271/403 (67%), Gaps = 4/403 (0%) Query: 339 SVVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVLSAMGDTTDHLIELAKTIDENP 398 +++V KFGG ++ VE++E+VAEK+ K ++ G VVV+SAM T+ LI+LAK I E P Sbjct: 2 ALIVQKFGGTSVGTVERIEQVAEKVKKFREGGDDIVVVVSAMSGETNRLIDLAKQISEQP 61 Query: 399 DPRELDLLLSTGEIQSVALMSIALRKRGYKAISFTGNQLKIITDKRYGSARIIDINTDII 458 PRELD+++STGE ++AL+++AL KRG A+S+TGNQ++I+TD + ARI+ I+ I Sbjct: 62 VPRELDVMVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSAHTKARILQIDGQRI 121 Query: 459 SRYLKQDFIPVVAGFQGITETGDITTLGRGGSDLTAIALAYSLGADLCELYKDVDGVYTA 518 R +K + VVAGFQG+ E G+ITTLGRGGSD T +ALA +L AD C++Y DVDGVYT Sbjct: 122 QRDIKAGRVVVVAGFQGVDEKGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYTT 181 Query: 519 DPRIVKDARVIKELSWEEMIELSRHGAQVLQARAAEFARKYGVKVLIKNAHKETRGTLIW 578 DPR+V A+ + ++++EEM+E++ G++VLQ RA EFA KY V + + ++ +E GTLI Sbjct: 182 DPRVVAKAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYSVPLRVLHSFQEGPGTLIT 241 Query: 579 --EGTKVENPIVRAVTFEDGMAKVVLKDVPDKPGVAARIMRTLSQMGVNIDMIIQGMKSG 636 E +E PI+ + F AK+ ++ VPD PGVA +I+ +S V +DMI+Q + Sbjct: 242 LDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANVEVDMIVQNVAHD 301 Query: 637 EYNTVAFIVPESQLGKLDIDLLKTRSE--AKEIIIEKGLAKVSIVGVNLTSTPEISATLF 694 F V + L +E A+E+I + +AKVSIVGV + S +++ +F Sbjct: 302 NTTDFTFTVHRNDYNNALQVLQGIAAEMGAREVIGDTDIAKVSIVGVGMRSHAGVASRMF 361 Query: 695 ETLANEGINIDMISASSSRISVIIDGKYVEDAVKAIHSRFELD 737 E LA E INI MIS S ++SV+I+ KY+E AV+A+H+ FELD Sbjct: 362 EALAKENINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELD 404 Lambda K H 0.318 0.137 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 745 Number of extensions: 35 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 739 Length of database: 412 Length adjustment: 36 Effective length of query: 703 Effective length of database: 376 Effective search space: 264328 Effective search space used: 264328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory