GapMind for Amino acid biosynthesis

 

Alignments for a candidate for proB in Pseudomonas stutzeri RCH2

Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate GFF3320 Psest_3384 glutamate 5-kinase

Query= BRENDA::P0A7B5
         (367 letters)



>FitnessBrowser__psRCH2:GFF3320
          Length = 372

 Score =  289 bits (739), Expect = 1e-82
 Identities = 158/366 (43%), Positives = 224/366 (61%), Gaps = 1/366 (0%)

Query: 1   MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL 60
           +S ++  VVK+G+++LT   R L++A +   V Q   L  AG  +V+V+SGA+AAG   L
Sbjct: 5   VSGARRWVVKIGSALLTADGRGLDQAAMAVWVDQMVALREAGVELVLVSSGAVAAGMSRL 64

Query: 61  GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT 120
           G+   P  +   Q  AAVGQ  LI+ WE  F+       Q+L+T  D+ DR+R+LNAR T
Sbjct: 65  GWSSRPKAVHELQAAAAVGQMGLIRAWESSFARCDQQTAQILVTHDDLSDRKRYLNARST 124

Query: 121 LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPR 180
           LR L+D  +VPVINEND V T EI+ GDND L AL A L  AD L++LTD+ G++ ADPR
Sbjct: 125 LRTLIDLGVVPVINENDTVVTDEIRFGDNDTLGALVANLVEADLLVILTDRDGMFDADPR 184

Query: 181 SNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPG 240
            NPQA LI +    D AL A+AG +   LG GGM TKL+AA +A R+G  T+I  G    
Sbjct: 185 FNPQANLISEARADDPALDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTVIVGGRIEQ 244

Query: 241 VIGDVMEGISVGTLFHAQATPLENRKRWIFG-APPAGEITVDEGATAAILERGSSLLPKG 299
           V+  +  G  +GTL   + +    RK+W+ G     G +T+D+GA  A+ +   SLLP G
Sbjct: 245 VLARLKAGERLGTLLAPECSRHAARKQWLAGHLQTRGTLTLDDGAVHALRQGNRSLLPVG 304

Query: 300 IKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAV 359
           +++V G F RGE++     +G ++A G+  Y++   +RI G  S EI+ +LGY   P  +
Sbjct: 305 VRAVQGAFRRGEMVVCVGPQGAEVARGLVNYSAAEAQRILGRPSDEIEKLLGYVDEPELI 364

Query: 360 HRDDMI 365
           HRD+MI
Sbjct: 365 HRDNMI 370


Lambda     K      H
   0.318    0.135    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 368
Number of extensions: 18
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 367
Length of database: 372
Length adjustment: 30
Effective length of query: 337
Effective length of database: 342
Effective search space:   115254
Effective search space used:   115254
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

Align candidate GFF3320 Psest_3384 (glutamate 5-kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))

Software error:

../bin/blast/fastacmd -i /tmp/list.32197.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.32197.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.