GapMind for Amino acid biosynthesis

 

Alignments for a candidate for proC in Pseudomonas stutzeri RCH2

Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate GFF282 Psest_0283 pyrroline-5-carboxylate reductase

Query= SwissProt::P22008
         (273 letters)



>FitnessBrowser__psRCH2:GFF282
          Length = 274

 Score =  389 bits (998), Expect = e-113
 Identities = 207/274 (75%), Positives = 235/274 (85%), Gaps = 1/274 (0%)

Query: 1   MSTPRIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIDVVESNAEA 60
           M +PRIAFIGAGNMAASLIGGLRAQGV A  IRASDPGAEQRAKI+ E  I     NA+A
Sbjct: 1   MISPRIAFIGAGNMAASLIGGLRAQGVAAEAIRASDPGAEQRAKISAEHGIQTFAQNADA 60

Query: 61  VADADVVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCASLEAWLG-QPRPVVRCM 119
           +A ADVVVLSVKPQ M++VC+ L P L    LIVSIAAGI C SL+ WLG +P+ +VRCM
Sbjct: 61  LAGADVVVLSVKPQVMQSVCRDLVPHLDHAPLIVSIAAGISCDSLQRWLGPRPQAIVRCM 120

Query: 120 PNTPALLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGPAY 179
           PNTPALLRQG SGL+ANAQVSA Q +QA QLLSAVGIALWL++E  IDAVTAVSGSGPAY
Sbjct: 121 PNTPALLRQGVSGLFANAQVSAEQKQQAEQLLSAVGIALWLEEERLIDAVTAVSGSGPAY 180

Query: 180 FFLLMQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTTEA 239
           FFLL++AMT AGE+LGL R+TA++LT+QTALGAA+MA  S+V+ AELRRRVTSPNGTTEA
Sbjct: 181 FFLLIEAMTAAGEQLGLPRDTAAQLTMQTALGAARMACESDVDAAELRRRVTSPNGTTEA 240

Query: 240 AIKSFQANGFEALVEQALNAASQRSAELAEQLGQ 273
           AIK+FQA GFE LV+QALNAA+QRSAELAEQLGQ
Sbjct: 241 AIKAFQAGGFERLVQQALNAAAQRSAELAEQLGQ 274


Lambda     K      H
   0.315    0.127    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 291
Number of extensions: 6
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 273
Length of database: 274
Length adjustment: 25
Effective length of query: 248
Effective length of database: 249
Effective search space:    61752
Effective search space used:    61752
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 47 (22.7 bits)

Align candidate GFF282 Psest_0283 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))

Software error:

../bin/blast/fastacmd -i /tmp/list.25569.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.25569.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.