Align Phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate GFF2734 Psest_2788 Phosphoglycerate dehydrogenase and related dehydrogenases
Query= reanno::SB2B:6938941 (308 letters) >FitnessBrowser__psRCH2:GFF2734 Length = 310 Score = 115 bits (289), Expect = 1e-30 Identities = 88/279 (31%), Positives = 122/279 (43%), Gaps = 7/279 (2%) Query: 32 DNPANIRLADIWLAEPGLAAPLVNHASGLRWMQSTFAGVDLLVKPRQRRDYLLTN-VRGI 90 +N I A + PG L N LR +QS +AGVD L+ D + V Sbjct: 37 ENAGLITAAVVANPPPGSLQGLPN----LRLIQSLWAGVDRLLNDPSLPDVPVARMVDPA 92 Query: 91 FGPLMSEYLFGYLLARQREHDLYKSQQQQKLWLPGSYKTLQGSELLLLGTGSIAKHLAQT 150 M+E L+ R + QQ + W P + ++ LLGTG + + A Sbjct: 93 MSAAMAETALWATLSLHRHFYAFARQQHAREWQPLPQRRADEIQVTLLGTGQMGRACAMR 152 Query: 151 AKHFGMKVAGINRSAKATEGFDEVATLEALPTLMARADAIASILPSTEATRGILNENILA 210 G +V G N EG ++AL L+AR+D + ++LP T T +L+ Sbjct: 153 LLALGYRVTGWNLRGGTLEGLPLEHGMDALWPLLARSDIVLNLLPLTAQTSDLLDRRFFN 212 Query: 211 RMKPDAVLFNLGRGD-VLDLDALERQLRQHPQQQAVLDVFNQEPLPEDHPIWGLGNVIVT 269 ++P A L NL RG V++ D L+ L AVLDVF EPLP +HP W V V Sbjct: 213 ALRPGAGLVNLARGGHVVETDLLQA-LASAQVSHAVLDVFRNEPLPPEHPFWSHPQVTVL 271 Query: 270 PHIAAPSFPEQVAEIFSSNYHKFLLGETLSHRVNFERGY 308 PH+AA + A I N G+ L V RGY Sbjct: 272 PHVAAATDMRSAARIVVQNLRALRDGQPLRDLVERSRGY 310 Lambda K H 0.320 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 310 Length adjustment: 27 Effective length of query: 281 Effective length of database: 283 Effective search space: 79523 Effective search space used: 79523 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory